Recombinant Human PTHLH protein, GST-tagged

Cat.No. : PTHLH-301482H
Product Overview : Recombinant Human PTHLH (37-175 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ala37-Arg175
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name PTHLH parathyroid hormone-like hormone [ Homo sapiens ]
Official Symbol PTHLH
Synonyms PTHLH; parathyroid hormone-like hormone; parathyroid hormone-related protein; HHM; osteostatin; PLP; PTHR; PTHRP; PTH-rP; PTH-related protein; parathyroid hormone-like related protein; BDE2; MGC14611;
Gene ID 5744
mRNA Refseq NM_002820
Protein Refseq NP_002811
UniProt ID P12272

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTHLH Products

Required fields are marked with *

My Review for All PTHLH Products

Required fields are marked with *

0
cart-icon