Recombinant Human PTHLH protein, GST-tagged
Cat.No. : | PTHLH-301482H |
Product Overview : | Recombinant Human PTHLH (37-175 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ala37-Arg175 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PTHLH parathyroid hormone-like hormone [ Homo sapiens ] |
Official Symbol | PTHLH |
Synonyms | PTHLH; parathyroid hormone-like hormone; parathyroid hormone-related protein; HHM; osteostatin; PLP; PTHR; PTHRP; PTH-rP; PTH-related protein; parathyroid hormone-like related protein; BDE2; MGC14611; |
Gene ID | 5744 |
mRNA Refseq | NM_002820 |
Protein Refseq | NP_002811 |
UniProt ID | P12272 |
◆ Recombinant Proteins | ||
PTHLH-7766C | Recombinant Chicken PTHLH protein, His & S-tagged | +Inquiry |
PTHLH-7764C | Recombinant Cattle PTHLH protein, His & S-tagged | +Inquiry |
PTHLH-6703H | Recombinant Human PTHLH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PTHLH-664H | Recombinant Human PTHLH protein | +Inquiry |
PTHLH-666H | Recombinant Human PTHLH Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PTHLH-322H | Recombinant Human PTHLH Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTHLH-2703HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
PTHLH-2702HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
PTHLH-2701HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTHLH Products
Required fields are marked with *
My Review for All PTHLH Products
Required fields are marked with *
0
Inquiry Basket