"PTHLH" Related Products

Expand

Recombinant Human PTHLH protein, His/S-tagged

Cat.No. : PTHLH-113H
Product Overview : Recombinant Human PTHLH protein (Ala37-His177), fused to His/S-tag at N-terminus, was expressed in E.coli.
Description : The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone.
Source : E.coli
Species : Human
Tag : His/S
Form : Supplied as lyophilized form in PBS, pH7.4, containing 1mM DTT, 5% trehalose, 0.01% sarcosyl and preservative.
Molecular Mass : 21.7kDa
Protein length : 193
AA Sequence : MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Endotoxin : <1.0 EU per 1µg (determined by the LAL method).
Purity : >95%
Applications : SDS-PAGE; WB; ELISA; IP.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Reconstitution : Reconstitute in sterile PBS, pH7.2 - pH7.4.
SDS-PAGE of PTHLH-113H :

Gene Name : PTHLH
Official Symbol : PTHLH
Synonyms : HHM; PLP; BDE2; PTHR; PTHRP
Gene ID : 5744
mRNA Refseq : NM_198965.2
Protein Refseq : NP_945316.1
MIM : 168470
UniProt ID : P12272

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.