Recombinant Human PTP4A1 protein, GST-tagged
| Cat.No. : | PTP4A1-3663H |
| Product Overview : | Recombinant Human PTP4A1 protein(1-173 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 23, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-173 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PTP4A1 protein tyrosine phosphatase type IVA, member 1 [ Homo sapiens ] |
| Official Symbol | PTP4A1 |
| Synonyms | PTP4A1; protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase type IVA 1; PRL 1; PTPCAAX1; PTP(CAAXI); protein-tyrosine phosphatase 4a1; Protein tyrosine phosphatase IVA1; protein tyrosine phosphatase type IVA protein 1; protein-tyrosine phosphatase of regenerating liver 1; HH72; PRL1; PRL-1; PTP(CAAX1); DKFZp779M0721; |
| Gene ID | 7803 |
| mRNA Refseq | NM_003463 |
| Protein Refseq | NP_003454 |
| MIM | 601585 |
| UniProt ID | Q93096 |
| ◆ Recombinant Proteins | ||
| PTP4A1-1839C | Recombinant Chicken PTP4A1 | +Inquiry |
| PTP4A1-1850Z | Recombinant Zebrafish PTP4A1 | +Inquiry |
| PTP4A1-504H | Recombinant Human PTP4A1(2-173), His-tagged | +Inquiry |
| PTP4A1-2479H | Recombinant Human PTP4A1 protein, His-tagged | +Inquiry |
| PTP4A1-674H | Recombinant Human PTP4A1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTP4A1-2695HCL | Recombinant Human PTP4A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTP4A1 Products
Required fields are marked with *
My Review for All PTP4A1 Products
Required fields are marked with *
