Recombinant Human PTP4A1 protein, His-tagged
| Cat.No. : | PTP4A1-2479H |
| Product Overview : | Recombinant Human PTP4A1 protein(1-173 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | September 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-173 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PTP4A1 protein tyrosine phosphatase type IVA, member 1 [ Homo sapiens ] |
| Official Symbol | PTP4A1 |
| Synonyms | PTP4A1; protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase type IVA 1; PRL 1; PTPCAAX1; PTP(CAAXI); protein-tyrosine phosphatase 4a1; Protein tyrosine phosphatase IVA1; protein tyrosine phosphatase type IVA protein 1; protein-tyrosine phosphatase of regenerating liver 1; HH72; PRL1; PRL-1; PTP(CAAX1); DKFZp779M0721; |
| Gene ID | 7803 |
| mRNA Refseq | NM_003463 |
| Protein Refseq | NP_003454 |
| MIM | 601585 |
| UniProt ID | Q93096 |
| ◆ Recombinant Proteins | ||
| PTP4A1-952H | Recombinant Human PTP4A1, His-tagged | +Inquiry |
| Ptp4a1-5230M | Recombinant Mouse Ptp4a1 Protein, Myc/DDK-tagged | +Inquiry |
| PTP4A1-3663H | Recombinant Human PTP4A1 protein, GST-tagged | +Inquiry |
| PTP4A1-1850Z | Recombinant Zebrafish PTP4A1 | +Inquiry |
| PTP4A1-4646H | Recombinant Human PTP4A1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTP4A1-2695HCL | Recombinant Human PTP4A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTP4A1 Products
Required fields are marked with *
My Review for All PTP4A1 Products
Required fields are marked with *
