Recombinant Human PTP4A1 protein, His-tagged
Cat.No. : | PTP4A1-2479H |
Product Overview : | Recombinant Human PTP4A1 protein(1-173 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | September 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-173 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PTP4A1 protein tyrosine phosphatase type IVA, member 1 [ Homo sapiens ] |
Official Symbol | PTP4A1 |
Synonyms | PTP4A1; protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase type IVA 1; PRL 1; PTPCAAX1; PTP(CAAXI); protein-tyrosine phosphatase 4a1; Protein tyrosine phosphatase IVA1; protein tyrosine phosphatase type IVA protein 1; protein-tyrosine phosphatase of regenerating liver 1; HH72; PRL1; PRL-1; PTP(CAAX1); DKFZp779M0721; |
Gene ID | 7803 |
mRNA Refseq | NM_003463 |
Protein Refseq | NP_003454 |
MIM | 601585 |
UniProt ID | Q93096 |
◆ Recombinant Proteins | ||
PTP4A1-504H | Recombinant Human PTP4A1(2-173), His-tagged | +Inquiry |
PTP4A1-3663H | Recombinant Human PTP4A1 protein, GST-tagged | +Inquiry |
PTP4A1-3642H | Recombinant Human PTP4A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PTP4A1-4486R | Recombinant Rat PTP4A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTP4A1-952H | Recombinant Human PTP4A1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTP4A1-2695HCL | Recombinant Human PTP4A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTP4A1 Products
Required fields are marked with *
My Review for All PTP4A1 Products
Required fields are marked with *