Recombinant Human PTPN1 protein, His&Myc-tagged
Cat.No. : | PTPN1-3388H |
Product Overview : | Recombinant Human PTPN1 protein(P18031)(1-321aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-321aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.8 kDa |
AA Sequence : | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PTPN1 protein tyrosine phosphatase, non-receptor type 1 [ Homo sapiens ] |
Official Symbol | PTPN1 |
Synonyms | PTPN1; protein tyrosine phosphatase, non-receptor type 1; PTP1B; tyrosine-protein phosphatase non-receptor type 1; protein tyrosine phosphatase 1B; protein-tyrosine phosphatase 1B; protein tyrosine phosphatase, placental; |
Gene ID | 5770 |
mRNA Refseq | NM_002827 |
Protein Refseq | NP_002818 |
MIM | 176885 |
UniProt ID | P18031 |
◆ Recombinant Proteins | ||
PTPN1-081H | Active Recombinant Human PTPN1 Protein, Untagged | +Inquiry |
Ptpn1-5234M | Recombinant Mouse Ptpn1 Protein, Myc/DDK-tagged | +Inquiry |
PTPN1-764H | Recombinant Human PTPN1, His tagged | +Inquiry |
PTPN1-460H | Recombinant Human PTPN1, GST-tagged, Active | +Inquiry |
PTPN1-3704R | Recombinant Rhesus monkey PTPN1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPN1-2686HCL | Recombinant Human PTPN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTPN1 Products
Required fields are marked with *
My Review for All PTPN1 Products
Required fields are marked with *
0
Inquiry Basket