Recombinant Human PTPN20 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PTPN20-3076H
Product Overview : PTPN20B MS Standard C13 and N15-labeled recombinant protein (NP_001035822) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites of actin polymerization. A pseudogene of this gene has been defined on chromosome 10. Alternative splicing results in multiple transcript variants.
Molecular Mass : 39 kDa
AA Sequence : MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLDSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PTPN20 protein tyrosine phosphatase non-receptor type 20 [ Homo sapiens (human) ]
Official Symbol PTPN20
Synonyms PTPN20; protein tyrosine phosphatase non-receptor type 20; CT126; PTPN20A; PTPN20B; bA42B19.1; bA142I17.1; tyrosine-protein phosphatase non-receptor type 20; protein tyrosine phosphatase, non-receptor type 20A; protein tyrosine phosphatase, non-receptor type 20B; EC 3.1.3.48
Gene ID 26095
mRNA Refseq NM_001042363
Protein Refseq NP_001035822
MIM 610631
UniProt ID Q4JDL3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTPN20 Products

Required fields are marked with *

My Review for All PTPN20 Products

Required fields are marked with *

0
cart-icon