Recombinant Human PTPN20 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PTPN20-3076H
• Product Overview: PTPN20B MS Standard C13 and N15-labeled recombinant protein (NP_001035822) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites of actin polymerization. A pseudogene of this gene has been defined on chromosome 10. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 39 kDa
• AA Sequence: MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLDSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PTPN20 protein tyrosine phosphatase non-receptor type 20 [ Homo sapiens (human) ]
• Official Symbol: PTPN20
• Synonyms: PTPN20; protein tyrosine phosphatase non-receptor type 20; CT126; PTPN20A; PTPN20B; bA42B19.1; bA142I17.1; tyrosine-protein phosphatase non-receptor type 20; protein tyrosine phosphatase, non-receptor type 20A; protein tyrosine phosphatase, non-receptor type 20B; EC 3.1.3.48
• Gene ID: 26095
• mRNA Refseq: NM_001042363
• Protein Refseq: NP_001035822
• MIM: 610631
• UniProt ID: Q4JDL3