Recombinant Human PTPN20 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PTPN20-3076H |
Product Overview : | PTPN20B MS Standard C13 and N15-labeled recombinant protein (NP_001035822) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites of actin polymerization. A pseudogene of this gene has been defined on chromosome 10. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 39 kDa |
AA Sequence : | MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLDSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PTPN20 protein tyrosine phosphatase non-receptor type 20 [ Homo sapiens (human) ] |
Official Symbol | PTPN20 |
Synonyms | PTPN20; protein tyrosine phosphatase non-receptor type 20; CT126; PTPN20A; PTPN20B; bA42B19.1; bA142I17.1; tyrosine-protein phosphatase non-receptor type 20; protein tyrosine phosphatase, non-receptor type 20A; protein tyrosine phosphatase, non-receptor type 20B; EC 3.1.3.48 |
Gene ID | 26095 |
mRNA Refseq | NM_001042363 |
Protein Refseq | NP_001035822 |
MIM | 610631 |
UniProt ID | Q4JDL3 |
◆ Recombinant Proteins | ||
PTPN20-3133H | Recombinant Human PTPN20 Protein, MYC/DDK-tagged | +Inquiry |
Ptpn20-5239M | Recombinant Mouse Ptpn20 Protein, Myc/DDK-tagged | +Inquiry |
PTPN20-13681M | Recombinant Mouse PTPN20 Protein | +Inquiry |
PTPN20-7278M | Recombinant Mouse PTPN20 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPN20-3076H | Recombinant Human PTPN20 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPN20 Products
Required fields are marked with *
My Review for All PTPN20 Products
Required fields are marked with *