Recombinant Human PTPN5 protein, His-tagged
Cat.No. : | PTPN5-2057H |
Product Overview : | Recombinant Human PTPN5 protein(P54829)(181-290 aa), fused with C-terminal His tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 181-290 aa |
Form : | Phosphate buffered saline. |
Molecular Mass : | 15 kDa |
AASequence : | RRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEEL |
Storage : | Store at -20°C/-80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 µg/μl. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) [ Homo sapiens ] |
Official Symbol | PTPN5 |
Synonyms | PTPN5; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched); PTPSTEP; STEP; |
Gene ID | 5776 |
MIM | 176879 |
UniProt ID | P54829 |
◆ Recombinant Proteins | ||
PTPN5-8092H | Recombinant Human PTPN5 protein, His & T7-tagged | +Inquiry |
RFL31294MF | Recombinant Full Length Mouse Tyrosine-Protein Phosphatase Non-Receptor Type 5(Ptpn5) Protein, His-Tagged | +Inquiry |
PTPN5-3708R | Recombinant Rhesus monkey PTPN5 Protein, His-tagged | +Inquiry |
PTPN5-4834R | Recombinant Rat PTPN5 Protein | +Inquiry |
PTPN5-3638H | Recombinant Human PTPN5 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPN5-2682HCL | Recombinant Human PTPN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPN5 Products
Required fields are marked with *
My Review for All PTPN5 Products
Required fields are marked with *