Recombinant Human PTPN5 protein, His-tagged

• Cat.No.: PTPN5-2057H
• Product Overview: Recombinant Human PTPN5 protein(P54829)(181-290 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 181-290 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 15 kDa
• AASequence: RRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEEL
• Storage: Store at -20°C/-80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 µg/μl. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) [ Homo sapiens ]
• Official Symbol: PTPN5
• Synonyms: PTPN5; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched); PTPSTEP; STEP
• Gene ID: 5776
• MIM: 176879
• UniProt ID: P54829