Recombinant Human PTPN5 protein, His-tagged
| Cat.No. : | PTPN5-2057H |
| Product Overview : | Recombinant Human PTPN5 protein(P54829)(181-290 aa), fused with C-terminal His tag, was expressed in E.coli. |
| Availability | January 15, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 181-290 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 15 kDa |
| AASequence : | RRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEEL |
| Storage : | Store at -20°C/-80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 µg/μl. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) [ Homo sapiens ] |
| Official Symbol | PTPN5 |
| Synonyms | PTPN5; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched); PTPSTEP; STEP; |
| Gene ID | 5776 |
| MIM | 176879 |
| UniProt ID | P54829 |
| ◆ Recombinant Proteins | ||
| PTPN5-3058H | Recombinant Human PTPN5 protein, His-tagged | +Inquiry |
| PTPN5-7282M | Recombinant Mouse PTPN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PTPN5-1106HFL | Recombinant Full Length Human PTPN5 Protein, C-Flag-tagged | +Inquiry |
| Ptpn5-5241M | Recombinant Mouse Ptpn5 Protein, Myc/DDK-tagged | +Inquiry |
| PTPN5-13687M | Recombinant Mouse PTPN5 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTPN5-2682HCL | Recombinant Human PTPN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPN5 Products
Required fields are marked with *
My Review for All PTPN5 Products
Required fields are marked with *
