Recombinant Human PTPN5 protein, His-tagged

Cat.No. : PTPN5-2057H
Product Overview : Recombinant Human PTPN5 protein(P54829)(181-290 aa), fused with C-terminal His tag, was expressed in E.coli.
Availability July 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 181-290 aa
Form : Phosphate buffered saline.
Molecular Mass : 15 kDa
AASequence : RRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEEL
Storage : Store at -20°C/-80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 µg/μl. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name PTPN5 protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) [ Homo sapiens ]
Official Symbol PTPN5
Synonyms PTPN5; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched); PTPSTEP; STEP;
Gene ID 5776
MIM 176879
UniProt ID P54829

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTPN5 Products

Required fields are marked with *

My Review for All PTPN5 Products

Required fields are marked with *

0
cart-icon