Recombinant Human PTPRN Protein, His-tagged
| Cat.No. : | PTPRN-678H |
| Product Overview : | Recombinant Human PTPRN, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 121-210 a.a. |
| Description : | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. Alternate splicing results in multiple transcript variants. |
| Form : | Supplied as a 0.2 µM filtered solution of PBS, pH7.4 |
| Molecular Mass : | 22.9kD |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANGGGGSGGGGSGGGGSWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLL |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | PTPRN protein tyrosine phosphatase, receptor type, N [ Homo sapiens ] |
| Official Symbol | PTPRN |
| Synonyms | PTPRN; protein tyrosine phosphatase, receptor type, N; receptor-type tyrosine-protein phosphatase-like N; IA 2; ICA 512; PTP IA-2; islet cell antigen 2; islet cell antigen 512; islet cell autoantigen 3; protein tyrosine phosphatase-like N; IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; FLJ16131; |
| Gene ID | 5798 |
| mRNA Refseq | NM_001199763 |
| Protein Refseq | NP_001186692 |
| MIM | 601773 |
| UniProt ID | Q16849 |
| ◆ Recombinant Proteins | ||
| PTPRN-457H | Recombinant Human PTPRN, GST-tagged | +Inquiry |
| PTPRN-675H | Recombinant Human PTPRN Protein, DDK-tagged | +Inquiry |
| PTPRN-8H | Recombinant Human PTPRN Protein, His (Fc)-Avi-tagged | +Inquiry |
| PTPRN-6110H | Recombinant Human PTPRN Protein (His603-Gln979), N-MAT tagged | +Inquiry |
| PTPRN-5754H | Recombinant Human PTPRN protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTPRN-1440HCL | Recombinant Human PTPRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPRN Products
Required fields are marked with *
My Review for All PTPRN Products
Required fields are marked with *
