Recombinant Human PTPRZ1 Protein (36-300 aa), His-tagged
Cat.No. : | PTPRZ1-2344H |
Product Overview : | Recombinant Human PTPRZ1 Protein (36-300 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 36-300 aa |
Description : | Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the bryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual mory, probably via the dephosphorylation of proteins that are part of important signaling cascades. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 32.1 kDa |
AA Sequence : | IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | PTPRZ1 protein tyrosine phosphatase, receptor-type, Z polypeptide 1 [ Homo sapiens ] |
Official Symbol | PTPRZ1 |
Synonyms | PTPRZ1; PTPRZ, PTPZ; phosphacan; PTP18; RPTPB; R-PTP-zeta-2; PTPZ; HPTPZ; PTPRZ; HPTPzeta; PTP-ZETA; RPTPbeta; |
Gene ID | 5803 |
mRNA Refseq | NM_001206838 |
Protein Refseq | NP_001193767 |
MIM | 176891 |
UniProt ID | P23471 |
◆ Recombinant Proteins | ||
PTPRZ1-4258C | Recombinant Chicken PTPRZ1 | +Inquiry |
PTPRZ1-6114H | Recombinant Human PTPRZ1 Protein (Leu32-Glu189), N-His tagged | +Inquiry |
PTPRZ1-4847R | Recombinant Rat PTPRZ1 Protein | +Inquiry |
Ptprz1-8110M | Recombinant Mouse Ptprz1 protein, His & T7-tagged | +Inquiry |
PTPRZ1-3684H | Recombinant Human PTPRZ1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPRZ1 Products
Required fields are marked with *
My Review for All PTPRZ1 Products
Required fields are marked with *
0
Inquiry Basket