Recombinant Human PTRH2, His-tagged

Cat.No. : PTRH2-31259TH
Product Overview : Recombinant full lenght Human PTRH2 with an N terminal His tag; 137aa, 14.9kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 116 amino acids
Description : PTRH2 (peptidyl-tRNA hydrolase 2), also known as BIT1, is a mitochondrial protein. During apoptosis, PTRH2 is released from the mitochondria to the cytoplasm.
Conjugation : HIS
Molecular Weight : 14.900kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: 0% NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
Sequence Similarities : Belongs to the PTH2 family.
Gene Name PTRH2 peptidyl-tRNA hydrolase 2 [ Homo sapiens ]
Official Symbol PTRH2
Synonyms PTRH2; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; Bcl 2 inhibitor of transcription; BIT1; CGI 147; PTH2;
Gene ID 51651
mRNA Refseq NM_016077
Protein Refseq NP_057161
MIM 608625
Uniprot ID Q9Y3E5
Chromosome Location 17q23.2
Function aminoacyl-tRNA hydrolase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTRH2 Products

Required fields are marked with *

My Review for All PTRH2 Products

Required fields are marked with *

0
cart-icon
0
compare icon