Recombinant Human PVALB protein, GST-tagged
Cat.No. : | PVALB-301464H |
Product Overview : | Recombinant Human PVALB (2-110 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Lys2-Ser110 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PVALB parvalbumin [ Homo sapiens ] |
Official Symbol | PVALB |
Synonyms | PVALB; parvalbumin; parvalbumin alpha; D22S749; MGC116759; |
Gene ID | 5816 |
mRNA Refseq | NM_002854 |
Protein Refseq | NP_002845 |
MIM | 168890 |
UniProt ID | P20472 |
◆ Recombinant Proteins | ||
PVALB-2871H | Recombinant Full Length Human PVALB, His-tagged | +Inquiry |
PVALB-427H | Recombinant Human Parvalbumin / PVALB Protein | +Inquiry |
PVALB-7306M | Recombinant Mouse PVALB Protein, His (Fc)-Avi-tagged | +Inquiry |
PVALB-13729M | Recombinant Mouse PVALB Protein | +Inquiry |
PVALB-5262C | Recombinant Cat PVALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVALB-2658HCL | Recombinant Human PVALB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PVALB Products
Required fields are marked with *
My Review for All PVALB Products
Required fields are marked with *