Recombinant Human PVR Protein, C-His-tagged
Cat.No. : | PVR-123H |
Product Overview : | Recombinant Human PVR Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Poliovirus receptor (PVR, CD155) is an immunoglobulin-like, transmembrane glycoprotein originally described as a mediator of poliovirus attachment to cells and later identified as important in adherens junction formation. Also known as nectin-like 5 (Necl-5), PVR binds nectin-3 and interacts with integrin αvβ3 and PDGFR to regulate integrin clustering and focal contact formation at the leading edge of migrating cells. Research studies demonstrate that PVR and nectin-3 regulate contact inhibition during cell motility and proliferation in transformed 3T3 cells. Additional research indicates that PVR (CD155, Necl-5) expression may play a role in invasiveness of lung adenocarcinoma. In the immune system, CD155 plays a role in natural killer (NK) cell-mediated cytotoxicity. |
Molecular Mass : | ~36 kDa |
AA Sequence : | WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | PVR poliovirus receptor [ Homo sapiens (human) ] |
Official Symbol | PVR |
Synonyms | PVR; poliovirus receptor; PVS; CD155; HVED; Necl 5; NECL5; nectin like 5; Tage4; nectin-like 5; nectin-like protein 5; TAGE4; Necl-5; FLJ25946; |
Gene ID | 5817 |
mRNA Refseq | NM_001135768 |
Protein Refseq | NP_001129240 |
MIM | 173850 |
UniProt ID | P15151 |
◆ Recombinant Proteins | ||
Pvr-623M | Recombinant Mouse Pvr, Fc-His tagged | +Inquiry |
PVR-3141HAF488 | Recombinant Human PVR Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
PVR-3395H | Recombinant Human PVR protein, His-SUMO-tagged | +Inquiry |
PVR-1542R | Recombinant Rhesus Monkey PVR Protein, hIgG1-tagged | +Inquiry |
PVR-622H | Recombinant Human PVR protein, Mouse IgG2a Fc-tagged, low endotoxin | +Inquiry |
◆ Native Proteins | ||
PVR-28H | Active Recombinant Human PVR Homodimer Protein, His tagged | +Inquiry |
PVR-09H | Recombinant Human PVR Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVR-2996MCL | Recombinant Mouse PVR cell lysate | +Inquiry |
PVR-2456HCL | Recombinant Human PVR cell lysate | +Inquiry |
PVR-2272RCL | Recombinant Rat PVR cell lysate | +Inquiry |
PVR-2270CCL | Recombinant Cynomolgus PVR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PVR Products
Required fields are marked with *
My Review for All PVR Products
Required fields are marked with *