Recombinant Human PVR protein, His-SUMO-tagged
| Cat.No. : | PVR-3395H |
| Product Overview : | Recombinant Human PVR protein(P15151)(21-343aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 21-343aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.1 kDa |
| AA Sequence : | WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PVR poliovirus receptor [ Homo sapiens ] |
| Official Symbol | PVR |
| Synonyms | PVR; poliovirus receptor; PVS; CD155; HVED; Necl 5; NECL5; nectin like 5; Tage4; nectin-like 5; nectin-like protein 5; TAGE4; Necl-5; FLJ25946; |
| Gene ID | 5817 |
| mRNA Refseq | NM_001135768 |
| Protein Refseq | NP_001129240 |
| MIM | 173850 |
| UniProt ID | P15151 |
| ◆ Recombinant Proteins | ||
| PVR-3531R | Recombinant Rhesus Macaque PVR Protein, His (Fc)-Avi-tagged | +Inquiry |
| PVR-620HAF647 | Recombinant Human PVR Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| Pvr-623M | Recombinant Mouse Pvr, Fc-His tagged | +Inquiry |
| Pvr-623MAF647 | Recombinant Mouse Pvr Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| PVR-3141HF | Recombinant Human PVR Protein, His-tagged, FITC conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PVR-2272RCL | Recombinant Rat PVR cell lysate | +Inquiry |
| PVR-2996MCL | Recombinant Mouse PVR cell lysate | +Inquiry |
| PVR-284HKCL | Human PVR Knockdown Cell Lysate | +Inquiry |
| PVR-2456HCL | Recombinant Human PVR cell lysate | +Inquiry |
| PVR-2270CCL | Recombinant Cynomolgus PVR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PVR Products
Required fields are marked with *
My Review for All PVR Products
Required fields are marked with *
