Recombinant Human PVR Protein, His tagged

Cat.No. : PVR-09H
Product Overview : Recombinant human PVR (21-343 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 21-343 aa
Description : The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
AASequence : WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNLEHHHHHH
Molecular Mass : 36.1 kDa
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Concentration : 1 mg/mL (determined by absorbance at 280nm)
Gene ID 5817
Gene Name PVR poliovirus receptor [ Homo sapiens (human) ]
Official Symbol 5817
Synonyms PVR; poliovirus receptor; PVS; CD155; HVED; Necl 5; NECL5; nectin like 5; Tage4; nectin-like 5; nectin-like protein 5; TAGE4; Necl-5; FLJ25946;
mRNA Refseq NM_006505
Official Symbol 2 PVR
Gene ID 2 5817
Gene Name 2 PVR poliovirus receptor [ Homo sapiens (human) ]
mRNA Refseq 2 NM_006505
Protein Refseq 2 NP_006496
MIM 2 173850
UniProt ID 2 P15151

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PVR Products

Required fields are marked with *

My Review for All PVR Products

Required fields are marked with *

0
cart-icon
0
compare icon