Recombinant Human PVR Protein, His tagged
| Cat.No. : | PVR-09H |
| Product Overview : | Recombinant human PVR (21-343 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 21-343 aa |
| Description : | The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Form : | Liquid |
| AASequence : | WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNLEHHHHHH |
| Molecular Mass : | 36.1 kDa |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Concentration : | 1 mg/mL (determined by absorbance at 280nm) |
| Gene ID | 5817 |
| Gene Name | PVR poliovirus receptor [ Homo sapiens (human) ] |
| Official Symbol | 5817 |
| Synonyms | PVR; poliovirus receptor; PVS; CD155; HVED; Necl 5; NECL5; nectin like 5; Tage4; nectin-like 5; nectin-like protein 5; TAGE4; Necl-5; FLJ25946; |
| mRNA Refseq | NM_006505 |
| Official Symbol 2 | PVR |
| Gene ID 2 | 5817 |
| Gene Name 2 | PVR poliovirus receptor [ Homo sapiens (human) ] |
| mRNA Refseq 2 | NM_006505 |
| Protein Refseq 2 | NP_006496 |
| MIM 2 | 173850 |
| UniProt ID 2 | P15151 |
| ◆ Recombinant Proteins | ||
| PVR-3141H | Active Recombinant Human PVR protein, His-tagged | +Inquiry |
| PVR-3141HAF555 | Recombinant Human PVR Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| Pvr-624M | Active Recombinant Mouse PVR Protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
| PVR-3157H | Recombinant Human PVR Protein, MYC/DDK-tagged | +Inquiry |
| PVR-5051H | Recombinant Human PVR Protein (Met1-Asn343), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PVR-284HKCL | Human PVR Knockdown Cell Lysate | +Inquiry |
| PVR-2456HCL | Recombinant Human PVR cell lysate | +Inquiry |
| PVR-2272RCL | Recombinant Rat PVR cell lysate | +Inquiry |
| PVR-2270CCL | Recombinant Cynomolgus PVR cell lysate | +Inquiry |
| PVR-2996MCL | Recombinant Mouse PVR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PVR Products
Required fields are marked with *
My Review for All PVR Products
Required fields are marked with *
