Recombinant Human PVR Protein, His tagged
Cat.No. : | PVR-09H |
Product Overview : | Recombinant human PVR (21-343 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 21-343 aa |
Description : | The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
AASequence : | WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNLEHHHHHH |
Molecular Mass : | 36.1 kDa |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Concentration : | 1 mg/mL (determined by absorbance at 280nm) |
Gene ID | 5817 |
Gene Name | PVR poliovirus receptor [ Homo sapiens (human) ] |
Official Symbol | 5817 |
Synonyms | PVR; poliovirus receptor; PVS; CD155; HVED; Necl 5; NECL5; nectin like 5; Tage4; nectin-like 5; nectin-like protein 5; TAGE4; Necl-5; FLJ25946; |
mRNA Refseq | NM_006505 |
Official Symbol 2 | PVR |
Gene ID 2 | 5817 |
Gene Name 2 | PVR poliovirus receptor [ Homo sapiens (human) ] |
mRNA Refseq 2 | NM_006505 |
Protein Refseq 2 | NP_006496 |
MIM 2 | 173850 |
UniProt ID 2 | P15151 |
◆ Recombinant Proteins | ||
PVR-620HAF488 | Recombinant Human PVR Protein, hFc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
PVR-620H | Recombinant Human PVR protein, hFc-tagged | +Inquiry |
PVR-3141H | Active Recombinant Human PVR protein, His-tagged | +Inquiry |
PVR-3116CF | Recombinant Monkey PVR Protein, His-tagged, FITC conjugated | +Inquiry |
PVR-308H | Active Recombinant Human PVR protein | +Inquiry |
◆ Native Proteins | ||
PVR-09H | Recombinant Human PVR Protein, His tagged | +Inquiry |
PVR-28H | Active Recombinant Human PVR Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVR-2456HCL | Recombinant Human PVR cell lysate | +Inquiry |
PVR-2270CCL | Recombinant Cynomolgus PVR cell lysate | +Inquiry |
PVR-2996MCL | Recombinant Mouse PVR cell lysate | +Inquiry |
PVR-2272RCL | Recombinant Rat PVR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PVR Products
Required fields are marked with *
My Review for All PVR Products
Required fields are marked with *