Recombinant Human PXMP2 protein, His-tagged
Cat.No. : | PXMP2-3778H |
Product Overview : | Recombinant Human PXMP2 protein(126-184 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 126-184 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | FLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAAL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PXMP2 peroxisomal membrane protein 2, 22kDa [ Homo sapiens ] |
Official Symbol | PXMP2 |
Synonyms | PXMP2; peroxisomal membrane protein 2, 22kDa; peroxisomal membrane protein 2 (22kD); peroxisomal membrane protein 2; PMP22; 22 kDa peroxisomal membrane protein; FLJ54922; |
Gene ID | 5827 |
mRNA Refseq | NM_018663 |
Protein Refseq | NP_061133 |
UniProt ID | Q9NR77 |
◆ Recombinant Proteins | ||
PXMP2-735H | Recombinant Human PXMP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PXMP2-7314M | Recombinant Mouse PXMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PXMP2-3778H | Recombinant Human PXMP2 protein, His-tagged | +Inquiry |
PXMP2-4513R | Recombinant Rat PXMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PXMP2-3534R | Recombinant Rhesus Macaque PXMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PXMP2-2652HCL | Recombinant Human PXMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PXMP2 Products
Required fields are marked with *
My Review for All PXMP2 Products
Required fields are marked with *
0
Inquiry Basket