Recombinant Human PYCR1, His-tagged
| Cat.No. : | PYCR1-31273TH |
| Product Overview : | Recombinant full length Human PYCR1 protein with an N terminal His tag. Predicted MWt: 34 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternate splicing results in two transcript variants encoding different isoforms. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 57 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLA TVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFI LDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPR VIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSV GFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVK MGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVS SPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKVKLDSPAGTALSPSGHTKLLP RSLAPAGKD |
| Full Length : | Full L. |
| Gene Name | PYCR1 pyrroline-5-carboxylate reductase 1 [ Homo sapiens ] |
| Official Symbol | PYCR1 |
| Synonyms | PYCR1; pyrroline-5-carboxylate reductase 1; pyrroline-5-carboxylate reductase 1, mitochondrial; P5C; |
| Gene ID | 5831 |
| mRNA Refseq | NM_006907 |
| Protein Refseq | NP_008838 |
| MIM | 179035 |
| Uniprot ID | P32322 |
| Chromosome Location | 17 |
| Pathway | Amino acid synthesis and interconversion (transamination), organism-specific biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; |
| Function | identical protein binding; nucleotide binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; pyrroline-5-carboxylate reductase activity; |
| ◆ Recombinant Proteins | ||
| PYCR1-3396H | Recombinant Human PYCR1 protein, His-SUMO-tagged | +Inquiry |
| PYCR1-5744H | Recombinant Human PYCR1 protein, His-tagged | +Inquiry |
| PYCR1-935H | Recombinant Human Pyrroline-5-carboxylate Reductase 1, His-tagged | +Inquiry |
| CRY22 | Recombinant Human Pyrroline-5-carboxylate Reductase 1 | +Inquiry |
| PYCR1-3536R | Recombinant Rhesus Macaque PYCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PYCR1-1448HCL | Recombinant Human PYCR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYCR1 Products
Required fields are marked with *
My Review for All PYCR1 Products
Required fields are marked with *
