Recombinant Human PYDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PYDC2-2943H
• Product Overview: PYDC2 MS Standard C13 and N15-labeled recombinant protein (NP_001076777) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: May play a role in innate immunity by disrupting the interaction between PYCARD and NLRP3, thereby regulating the NLRP3 inflammasome. May also inhibit NF-kappa-B signaling distally by affecting the nuclear accumulation of RELA.
• Molecular Mass: 10.6 kDa
• AA Sequence: MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFTSHSCSYWAGMAAIQVFEKMNQTHLSGRADEHCVMPPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PYDC2 pyrin domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: PYDC2
• Synonyms: PYDC2; pyrin domain containing 2; POP2; cPOP2; pyrin domain-containing protein 2; cellular POP2; pyrin-only protein 2
• Gene ID: 152138
• mRNA Refseq: NM_001083308
• Protein Refseq: NP_001076777
• MIM: 615701
• UniProt ID: Q56P42