Recombinant Human PYDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PYDC2-2943H |
Product Overview : | PYDC2 MS Standard C13 and N15-labeled recombinant protein (NP_001076777) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May play a role in innate immunity by disrupting the interaction between PYCARD and NLRP3, thereby regulating the NLRP3 inflammasome. May also inhibit NF-kappa-B signaling distally by affecting the nuclear accumulation of RELA. |
Molecular Mass : | 10.6 kDa |
AA Sequence : | MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFTSHSCSYWAGMAAIQVFEKMNQTHLSGRADEHCVMPPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PYDC2 pyrin domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | PYDC2 |
Synonyms | PYDC2; pyrin domain containing 2; POP2; cPOP2; pyrin domain-containing protein 2; cellular POP2; pyrin-only protein 2 |
Gene ID | 152138 |
mRNA Refseq | NM_001083308 |
Protein Refseq | NP_001076777 |
MIM | 615701 |
UniProt ID | Q56P42 |
◆ Recombinant Proteins | ||
PYDC2-3721R | Recombinant Rhesus monkey PYDC2 Protein, His-tagged | +Inquiry |
PYDC2-2943H | Recombinant Human PYDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PYDC2-3538R | Recombinant Rhesus Macaque PYDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYDC2 Products
Required fields are marked with *
My Review for All PYDC2 Products
Required fields are marked with *