Recombinant Human PYDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PYDC2-2943H
Product Overview : PYDC2 MS Standard C13 and N15-labeled recombinant protein (NP_001076777) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May play a role in innate immunity by disrupting the interaction between PYCARD and NLRP3, thereby regulating the NLRP3 inflammasome. May also inhibit NF-kappa-B signaling distally by affecting the nuclear accumulation of RELA.
Molecular Mass : 10.6 kDa
AA Sequence : MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFTSHSCSYWAGMAAIQVFEKMNQTHLSGRADEHCVMPPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PYDC2 pyrin domain containing 2 [ Homo sapiens (human) ]
Official Symbol PYDC2
Synonyms PYDC2; pyrin domain containing 2; POP2; cPOP2; pyrin domain-containing protein 2; cellular POP2; pyrin-only protein 2
Gene ID 152138
mRNA Refseq NM_001083308
Protein Refseq NP_001076777
MIM 615701
UniProt ID Q56P42

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PYDC2 Products

Required fields are marked with *

My Review for All PYDC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon