Recombinant Human PYHIN1 protein, His-tagged
| Cat.No. : | PYHIN1-5763H |
| Product Overview : | Recombinant Human PYHIN1 protein(102-149 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 102-149 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | EVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PYHIN1 pyrin and HIN domain family, member 1 [ Homo sapiens ] |
| Official Symbol | PYHIN1 |
| Synonyms | PYHIN1; pyrin and HIN domain family, member 1; pyrin and HIN domain-containing protein 1; IFIX; MGC23885; interferon-inducible protein X; RP11-520H16.1; |
| Gene ID | 149628 |
| mRNA Refseq | NM_152501 |
| Protein Refseq | NP_689714 |
| MIM | 612677 |
| UniProt ID | Q6K0P9 |
| ◆ Recombinant Proteins | ||
| PYHIN1-0629H | Recombinant Human PYHIN1 Protein (M1-P492), Flag tagged | +Inquiry |
| PYHIN1-5763H | Recombinant Human PYHIN1 protein, His-tagged | +Inquiry |
| PYHIN1-5764H | Recombinant Human PYHIN1 protein, GST-tagged | +Inquiry |
| PYHIN1-13754M | Recombinant Mouse PYHIN1 Protein | +Inquiry |
| PYHIN1-7318M | Recombinant Mouse PYHIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PYHIN1-2643HCL | Recombinant Human PYHIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYHIN1 Products
Required fields are marked with *
My Review for All PYHIN1 Products
Required fields are marked with *



