Recombinant Human PYHIN1 protein, GST-tagged
Cat.No. : | PYHIN1-5764H |
Product Overview : | Recombinant Human PYHIN1 protein(102-149 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 102-149 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | EVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PYHIN1 pyrin and HIN domain family, member 1 [ Homo sapiens ] |
Official Symbol | PYHIN1 |
Synonyms | PYHIN1; pyrin and HIN domain family, member 1; pyrin and HIN domain-containing protein 1; IFIX; MGC23885; interferon-inducible protein X; RP11-520H16.1; |
Gene ID | 149628 |
mRNA Refseq | NM_152501 |
Protein Refseq | NP_689714 |
MIM | 612677 |
UniProt ID | Q6K0P9 |
◆ Recombinant Proteins | ||
PYHIN1-13754M | Recombinant Mouse PYHIN1 Protein | +Inquiry |
PYHIN1-5764H | Recombinant Human PYHIN1 protein, GST-tagged | +Inquiry |
PYHIN1-0629H | Recombinant Human PYHIN1 Protein (M1-P492), Flag tagged | +Inquiry |
PYHIN1-5763H | Recombinant Human PYHIN1 protein, His-tagged | +Inquiry |
PYHIN1-0630H | Recombinant Human PYHIN1 Protein (M1-P492), His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYHIN1-2643HCL | Recombinant Human PYHIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYHIN1 Products
Required fields are marked with *
My Review for All PYHIN1 Products
Required fields are marked with *