Recombinant Human QPCT Protein, His-SUMO-tagged
| Cat.No. : | QPCT-1347H |
| Product Overview : | Recombinant Human QPCT Protein (29-361aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 29-361 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 53.9 kDa |
| AA Sequence : | VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | QPCT glutaminyl-peptide cyclotransferase [ Homo sapiens ] |
| Official Symbol | QPCT |
| Synonyms | QPCT; glutaminyl-peptide cyclotransferase; GCT; glutaminyl cyclase; QC; EC; glutamyl cyclase; glutaminyl-tRNA cyclotransferase; sQC |
| Gene ID | 25797 |
| mRNA Refseq | NM_012413 |
| Protein Refseq | NP_036545 |
| MIM | 607065 |
| UniProt ID | Q16769 |
| ◆ Recombinant Proteins | ||
| QPCT-13762M | Recombinant Full Length Mouse Qpct protein, His-tagged | +Inquiry |
| QPCT-1474H | Recombinant Human QPCT protein, His-tagged | +Inquiry |
| QPCT-5790H | Recombinant Human QPCT Protein (Val29-Leu361), His tagged | +Inquiry |
| QPCT-1510H | Recombinant Human QPCT protein, His-tagged | +Inquiry |
| QPCT-322HFL | Recombinant Full Length Human QPCT Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| QPCT-001HCL | Recombinant Human QPCT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QPCT Products
Required fields are marked with *
My Review for All QPCT Products
Required fields are marked with *
