Recombinant Human QPCT Protein, His-SUMO-tagged

Cat.No. : QPCT-1347H
Product Overview : Recombinant Human QPCT Protein (29-361aa) was expressed in E. coli with N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 29-361 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 53.9 kDa
AA Sequence : VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name QPCT glutaminyl-peptide cyclotransferase [ Homo sapiens ]
Official Symbol QPCT
Synonyms QPCT; glutaminyl-peptide cyclotransferase; GCT; glutaminyl cyclase; QC; EC; glutamyl cyclase; glutaminyl-tRNA cyclotransferase; sQC
Gene ID 25797
mRNA Refseq NM_012413
Protein Refseq NP_036545
MIM 607065
UniProt ID Q16769

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All QPCT Products

Required fields are marked with *

My Review for All QPCT Products

Required fields are marked with *

0
cart-icon