Recombinant Human RAB10 protein, His-tagged
Cat.No. : | RAB10-2776H |
Product Overview : | Recombinant Human RAB10 protein(130-200 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 130-200 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RAB10 RAB10, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB10 |
Synonyms | RAB10; RAB10, member RAS oncogene family; ras-related protein Rab-10; ras related GTP binding protein; GTP-binding protein RAB10; ras-related GTP-binding protein; |
Gene ID | 10890 |
mRNA Refseq | NM_016131 |
Protein Refseq | NP_057215 |
MIM | 612672 |
UniProt ID | P61026 |
◆ Recombinant Proteins | ||
RAB10-2771C | Recombinant Chicken RAB10 | +Inquiry |
RAB10-7263H | Recombinant Full Length Human RAB10, His-tagged | +Inquiry |
RAB10-13780M | Recombinant Mouse RAB10 Protein | +Inquiry |
RAB10-7264H | Recombinant Human RAB10 protein, His-tagged | +Inquiry |
RAB10-7335M | Recombinant Mouse RAB10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB10-2632HCL | Recombinant Human RAB10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB10 Products
Required fields are marked with *
My Review for All RAB10 Products
Required fields are marked with *
0
Inquiry Basket