Recombinant Human RAB10 protein, His-tagged
| Cat.No. : | RAB10-2776H |
| Product Overview : | Recombinant Human RAB10 protein(130-200 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 130-200 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RAB10 RAB10, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB10 |
| Synonyms | RAB10; RAB10, member RAS oncogene family; ras-related protein Rab-10; ras related GTP binding protein; GTP-binding protein RAB10; ras-related GTP-binding protein; |
| Gene ID | 10890 |
| mRNA Refseq | NM_016131 |
| Protein Refseq | NP_057215 |
| MIM | 612672 |
| UniProt ID | P61026 |
| ◆ Recombinant Proteins | ||
| RAB10-2974H | Recombinant Full Length Human RAB10 Protein, T7-tagged | +Inquiry |
| RAB10-7263H | Recombinant Full Length Human RAB10, His-tagged | +Inquiry |
| RAB10-2776H | Recombinant Human RAB10 protein, His-tagged | +Inquiry |
| Rab10-5282M | Recombinant Mouse Rab10 Protein, Myc/DDK-tagged | +Inquiry |
| RAB10-687Z | Recombinant Zebrafish RAB10 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB10-2632HCL | Recombinant Human RAB10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB10 Products
Required fields are marked with *
My Review for All RAB10 Products
Required fields are marked with *
