Recombinant Human RAB14 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB14-6021H
Product Overview : RAB14 MS Standard C13 and N15-labeled recombinant protein (NP_057406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes.
Molecular Mass : 23.9 kDa
AA Sequence : MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB14 RAB14, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB14
Synonyms RAB14; RAB14, member RAS oncogene family; ras-related protein Rab-14; bA165P4.3 (member RAS oncogene family); F protein binding protein 1; FBP; RAB 14; small GTP binding protein RAB14; F protein-binding protein 1; RAB-14;
Gene ID 51552
mRNA Refseq NM_016322
Protein Refseq NP_057406
MIM 612673
UniProt ID P61106

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB14 Products

Required fields are marked with *

My Review for All RAB14 Products

Required fields are marked with *

0
cart-icon
0
compare icon