Recombinant Human RAB14 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RAB14-6021H |
Product Overview : | RAB14 MS Standard C13 and N15-labeled recombinant protein (NP_057406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes. |
Molecular Mass : | 23.9 kDa |
AA Sequence : | MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RAB14 RAB14, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB14 |
Synonyms | RAB14; RAB14, member RAS oncogene family; ras-related protein Rab-14; bA165P4.3 (member RAS oncogene family); F protein binding protein 1; FBP; RAB 14; small GTP binding protein RAB14; F protein-binding protein 1; RAB-14; |
Gene ID | 51552 |
mRNA Refseq | NM_016322 |
Protein Refseq | NP_057406 |
MIM | 612673 |
UniProt ID | P61106 |
◆ Recombinant Proteins | ||
RAB14-6021H | Recombinant Human RAB14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB14-11540Z | Recombinant Zebrafish RAB14 | +Inquiry |
RAB14-216H | Recombinant Human RAB14 protein, T7-tagged | +Inquiry |
Rab14-5291M | Recombinant Mouse Rab14 Protein, Myc/DDK-tagged | +Inquiry |
RAB14-3550R | Recombinant Rhesus Macaque RAB14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB14-2627HCL | Recombinant Human RAB14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB14 Products
Required fields are marked with *
My Review for All RAB14 Products
Required fields are marked with *