Recombinant Human RAB1B, His-tagged
| Cat.No. : | RAB1B-30221TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-201 of Human RAB1B with a N terminal His tag; 24 kDa: |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-201 a.a. |
| Description : | Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al. |
| Conjugation : | HIS |
| Form : | Lyophilised:reconstitution with 120 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYIST IGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYY RGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNK LLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNAT NVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVK PAGGGCC |
| Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
| Full Length : | Full L. |
| Gene Name | RAB1B RAB1B, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB1B |
| Synonyms | RAB1B; RAB1B, member RAS oncogene family; ras-related protein Rab-1B; |
| Gene ID | 81876 |
| mRNA Refseq | NM_030981 |
| Protein Refseq | NP_112243 |
| MIM | 612565 |
| Uniprot ID | Q9H0U4 |
| Chromosome Location | 11q13.1 |
| Pathway | Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; |
| Function | GTP binding; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| Rab1b-5295M | Recombinant Mouse Rab1b Protein, Myc/DDK-tagged | +Inquiry |
| RAB1B-834C | Recombinant Cynomolgus RAB1B Protein, His-tagged | +Inquiry |
| RAB1B-30195H | Recombinant Human RAB1B protein, GST-tagged | +Inquiry |
| RAB1B-3554R | Recombinant Rhesus Macaque RAB1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB1B-2105H | Recombinant Human RAB1B, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB1B-2622HCL | Recombinant Human RAB1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB1B Products
Required fields are marked with *
My Review for All RAB1B Products
Required fields are marked with *




