Recombinant Human RAB1B, His-tagged
Cat.No. : | RAB1B-30221TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-201 of Human RAB1B with a N terminal His tag; 24 kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-201 a.a. |
Description : | Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 120 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYIST IGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYY RGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNK LLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNAT NVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVK PAGGGCC |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
Full Length : | Full L. |
Gene Name | RAB1B RAB1B, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB1B |
Synonyms | RAB1B; RAB1B, member RAS oncogene family; ras-related protein Rab-1B; |
Gene ID | 81876 |
mRNA Refseq | NM_030981 |
Protein Refseq | NP_112243 |
MIM | 612565 |
Uniprot ID | Q9H0U4 |
Chromosome Location | 11q13.1 |
Pathway | Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; |
Function | GTP binding; nucleotide binding; |
◆ Recombinant Proteins | ||
RAB1B-3737R | Recombinant Rhesus monkey RAB1B Protein, His-tagged | +Inquiry |
RAB1B-3387H | Recombinant Human RAB1B, Member RAS Oncogene Family, His-tagged | +Inquiry |
RAB1B-577C | Recombinant Cynomolgus Monkey RAB1B Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB1B-3554R | Recombinant Rhesus Macaque RAB1B Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB1B-30195H | Recombinant Human RAB1B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB1B-2622HCL | Recombinant Human RAB1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB1B Products
Required fields are marked with *
My Review for All RAB1B Products
Required fields are marked with *
0
Inquiry Basket