Recombinant Human RAB1B protein, GST-tagged
| Cat.No. : | RAB1B-30195H |
| Product Overview : | Recombinant Human RAB1B (1-201 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Cys201 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | RAB1B RAB1B, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB1B |
| Synonyms | RAB1B; RAB1B, member RAS oncogene family; ras-related protein Rab-1B; small GTP-binding protein; |
| Gene ID | 81876 |
| mRNA Refseq | NM_030981 |
| Protein Refseq | NP_112243 |
| MIM | 612565 |
| UniProt ID | Q9H0U4 |
| ◆ Recombinant Proteins | ||
| Rab1b-5295M | Recombinant Mouse Rab1b Protein, Myc/DDK-tagged | +Inquiry |
| RAB1B-2105H | Recombinant Human RAB1B, His-tagged | +Inquiry |
| RAB1B-3554R | Recombinant Rhesus Macaque RAB1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB1B-684H | Recombinant Human RAB1B Protein, Fc-tagged | +Inquiry |
| RAB1B-3387H | Recombinant Human RAB1B, Member RAS Oncogene Family, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB1B-2622HCL | Recombinant Human RAB1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB1B Products
Required fields are marked with *
My Review for All RAB1B Products
Required fields are marked with *
