Recombinant Human RAB20 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RAB20-2287H |
| Product Overview : | RAB20 MS Standard C13 and N15-labeled recombinant protein (NP_060287) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Plays a role in apical endocytosis/recycling. Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in the fusion of phagosomes with lysosomes. |
| Molecular Mass : | 26.3 kDa |
| AA Sequence : | MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RAB20 RAB20, member RAS oncogene family [ Homo sapiens (human) ] |
| Official Symbol | RAB20 |
| Synonyms | RAB20; RAB20, member RAS oncogene family; ras-related protein Rab-20; FLJ20429; |
| Gene ID | 55647 |
| mRNA Refseq | NM_017817 |
| Protein Refseq | NP_060287 |
| UniProt ID | Q9NX57 |
| ◆ Recombinant Proteins | ||
| Rab20-5296M | Recombinant Mouse Rab20 Protein, Myc/DDK-tagged | +Inquiry |
| RAB20-2106H | Recombinant Human RAB20, GST-tagged | +Inquiry |
| RAB20-13795M | Recombinant Mouse RAB20 Protein | +Inquiry |
| RAB20-7344M | Recombinant Mouse RAB20 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB20-2287H | Recombinant Human RAB20 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB20-2621HCL | Recombinant Human RAB20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB20 Products
Required fields are marked with *
My Review for All RAB20 Products
Required fields are marked with *
