Recombinant Human RAB27A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RAB27A-3364H |
Product Overview : | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_004571) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RAB27A RAB27A, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB27A |
Synonyms | RAB27A; RAB27A, member RAS oncogene family; ras-related protein Rab-27A; GS2; HsT18676; RAB27; RAM; rab-27; GTP-binding protein Ram; MGC117246; |
Gene ID | 5873 |
mRNA Refseq | NM_004580 |
Protein Refseq | NP_004571 |
MIM | 603868 |
UniProt ID | P51159 |
◆ Recombinant Proteins | ||
RAB27A-3740R | Recombinant Rhesus monkey RAB27A Protein, His-tagged | +Inquiry |
RAB27A-4541R | Recombinant Rat RAB27A Protein, His (Fc)-Avi-tagged | +Inquiry |
Rab27a-1106R | Active Recombinant Rat RAB27A, Member RAS Oncogene Family | +Inquiry |
RAB27A-3338Z | Recombinant Zebrafish RAB27A | +Inquiry |
RAB27A-4044C | Recombinant Chicken RAB27A | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB27A-2613HCL | Recombinant Human RAB27A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB27A Products
Required fields are marked with *
My Review for All RAB27A Products
Required fields are marked with *