Recombinant Human RAB29 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RAB29-1349H |
| Product Overview : | RAB7L1 MS Standard C13 and N15-labeled recombinant protein (NP_001129134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | RAB29 (RAB29, Member RAS Oncogene Family) is a Protein Coding gene. Diseases associated with RAB29 include Kufor-Rakeb Syndrome and Frontotemporal Dementia. Among its related pathways are Metabolism of proteins and RAB geranylgeranylation. Gene Ontology (GO) annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is RAB38. |
| Molecular Mass : | 23.2 kDa |
| AA Sequence : | MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RAB29 RAB29, member RAS oncogene family [ Homo sapiens (human) ] |
| Official Symbol | RAB29 |
| Synonyms | RAB29; RAB29, member RAS oncogene family; RAB7L; RAB7L1; ras-related protein Rab-7L1; RAB7, member RAS oncogene family-like 1; rab-7-like protein 1; ras-related protein Rab-29 |
| Gene ID | 8934 |
| mRNA Refseq | NM_001135662 |
| Protein Refseq | NP_001129134 |
| MIM | 603949 |
| UniProt ID | O14966 |
| ◆ Recombinant Proteins | ||
| Rab29-5304M | Recombinant Mouse Rab29 Protein, Myc/DDK-tagged | +Inquiry |
| RAB29-5542H | Recombinant Human RAB29 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RAB29-1601HFL | Recombinant Full Length Human RAB29 Protein, C-Flag-tagged | +Inquiry |
| RAB29-1829H | Recombinant Human RAB29 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB29-1349H | Recombinant Human RAB29 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB29 Products
Required fields are marked with *
My Review for All RAB29 Products
Required fields are marked with *
