Recombinant Human RAB29 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB29-1349H
Product Overview : RAB7L1 MS Standard C13 and N15-labeled recombinant protein (NP_001129134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RAB29 (RAB29, Member RAS Oncogene Family) is a Protein Coding gene. Diseases associated with RAB29 include Kufor-Rakeb Syndrome and Frontotemporal Dementia. Among its related pathways are Metabolism of proteins and RAB geranylgeranylation. Gene Ontology (GO) annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is RAB38.
Molecular Mass : 23.2 kDa
AA Sequence : MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB29 RAB29, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB29
Synonyms RAB29; RAB29, member RAS oncogene family; RAB7L; RAB7L1; ras-related protein Rab-7L1; RAB7, member RAS oncogene family-like 1; rab-7-like protein 1; ras-related protein Rab-29
Gene ID 8934
mRNA Refseq NM_001135662
Protein Refseq NP_001129134
MIM 603949
UniProt ID O14966

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB29 Products

Required fields are marked with *

My Review for All RAB29 Products

Required fields are marked with *

0
cart-icon
0
compare icon