Recombinant Full Length Human RAB29 Protein, C-Flag-tagged
Cat.No. : | RAB29-1601HFL |
Product Overview : | Recombinant Full Length Human RAB29 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables several functions, including dynein complex binding activity; guanyl ribonucleotide binding activity; and kinesin binding activity. Involved in several processes, including positive regulation of T cell receptor signaling pathway; positive regulation of receptor recycling; and toxin transport. Located in several cellular components, including Golgi apparatus; endosome; and vacuole. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23 kDa |
AA Sequence : | MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERF TSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQID RFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | RAB29 RAB29, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB29 |
Synonyms | RAB7L; RAB7L1 |
Gene ID | 8934 |
mRNA Refseq | NM_003929.3 |
Protein Refseq | NP_003920.1 |
MIM | 603949 |
UniProt ID | O14966 |
◆ Recombinant Proteins | ||
RAB29-1601HFL | Recombinant Full Length Human RAB29 Protein, C-Flag-tagged | +Inquiry |
Rab29-5304M | Recombinant Mouse Rab29 Protein, Myc/DDK-tagged | +Inquiry |
RAB29-213H | Recombinant Human RAB7L1 Protein, MYC/DDK-tagged | +Inquiry |
RAB29-1829H | Recombinant Human RAB29 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB29-5542H | Recombinant Human RAB29 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB29 Products
Required fields are marked with *
My Review for All RAB29 Products
Required fields are marked with *
0
Inquiry Basket