Recombinant Human RAB31 protein, GST-tagged
Cat.No. : | RAB31-1784H |
Product Overview : | Recombinant Human RAB31 protein(1-195 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-195 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RAB31 RAB31, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB31 |
Synonyms | RAB31; RAB31, member RAS oncogene family; ras-related protein Rab-31; Rab22B; ras-related protein Rab-22B; |
Gene ID | 11031 |
mRNA Refseq | NM_006868 |
Protein Refseq | NP_006859 |
MIM | 605694 |
UniProt ID | Q13636 |
◆ Recombinant Proteins | ||
RAB31-3561R | Recombinant Rhesus Macaque RAB31 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB31-28751TH | Recombinant Human RAB31, His-tagged | +Inquiry |
RAB31-15858H | Recombinant Human RAB31, His-tagged | +Inquiry |
RAB31-4545R | Recombinant Rat RAB31 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB31-5595H | Recombinant Human RAB31, Member RAS Oncogene Family, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB31-2608HCL | Recombinant Human RAB31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB31 Products
Required fields are marked with *
My Review for All RAB31 Products
Required fields are marked with *