Recombinant Human RAB32, His-tagged
| Cat.No. : | RAB32-28750TH |
| Product Overview : | Recombinant full length Human RAB32 with N terminal His tag; 249 amino acids with tag, Predicted MWt 27.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 225 amino acids |
| Description : | Small GTP-binding proteins of the RAB family, such as RAB32, play essential roles in vesicle and granule targeting (Bao et al. |
| Conjugation : | HIS |
| Molecular Weight : | 27.600kDa inclusive of tags |
| Tissue specificity : | Widely expressed with high levels in heart, liver, kidney, bone marrow, testis, colon and fetal lung. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.08% DTT, 50% Glycerol, 1.17% Sodium chloride, 0.06% EDTA |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMAGGGAGDPGLGAAAA PAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHY RATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRV YYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPN GSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE TSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIK LDQETLRAENKSQCC |
| Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
| Gene Name | RAB32 RAB32, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB32 |
| Synonyms | RAB32; RAB32, member RAS oncogene family; ras-related protein Rab-32; |
| Gene ID | 10981 |
| mRNA Refseq | NM_006834 |
| Protein Refseq | NP_006825 |
| MIM | 612906 |
| Uniprot ID | Q13637 |
| Chromosome Location | 6q24.2 |
| Function | GTP binding; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| Rab32-5308M | Recombinant Mouse Rab32 Protein, Myc/DDK-tagged | +Inquiry |
| RAB32-3562R | Recombinant Rhesus Macaque RAB32 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB32-1109H | Active Recombinant Human RAB32, Member RAS Oncogene Family | +Inquiry |
| RAB32-28750TH | Recombinant Human RAB32, His-tagged | +Inquiry |
| RAB32-2495H | Recombinant Human RAB32, Member RAS Oncogene Family, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB32-2607HCL | Recombinant Human RAB32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB32 Products
Required fields are marked with *
My Review for All RAB32 Products
Required fields are marked with *
