Recombinant Human RAB34 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RAB34-891H |
Product Overview : | RAB34 MS Standard C13 and N15-labeled recombinant protein (NP_114140) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the activation of macropinocytosis. Alternative splicing of this gene results in multiple transcript variants. An alternatively spliced transcript variant produces the nine-amino acid residue-repeats (NARR) protein, which is a functionally distinct nucleolar protein resulting from a different reading frame. |
Molecular Mass : | 29.1 kDa |
AA Sequence : | MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDNNLYLTASKKKPTCCPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RAB34 RAB34, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB34 |
Synonyms | RAB34; RAB34, member RAS oncogene family; ras-related protein Rab-34; RAB39; RAH; ras-related protein Rah; ras-related protein Rab-39; |
Gene ID | 83871 |
mRNA Refseq | NM_031934 |
Protein Refseq | NP_114140 |
MIM | 610917 |
UniProt ID | P0DI83 |
◆ Recombinant Proteins | ||
RAB34-6746H | Recombinant Human RAB34 protein, GST-tagged | +Inquiry |
RAB34-6745H | Recombinant Human RAB34 protein, His-tagged | +Inquiry |
RAB34-4546R | Recombinant Rat RAB34 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB34-1110H | Active Recombinant Human RAB34, Member RAS Oncogene Family, GST-tagged | +Inquiry |
RAB34-1291H | Recombinant Human RAB34, Member RAS Oncogene Family, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB34-2605HCL | Recombinant Human RAB34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB34 Products
Required fields are marked with *
My Review for All RAB34 Products
Required fields are marked with *
0
Inquiry Basket