Recombinant Human RAB5C protein, His-SUMO-tagged
Cat.No. : | RAB5C-3404H |
Product Overview : | Recombinant Human RAB5C protein(P51148)(1-216aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-216aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.5 kDa |
AA Sequence : | MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RAB5C RAB5C, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB5C |
Synonyms | RAB5C; RAB5C, member RAS oncogene family; RABL; ras-related protein Rab-5C; RAB; member of RAS oncogene family like; member of RAS oncogene family; RAB5CL; RAB5C, member of RAS oncogene family; L1880; RAB5L; MGC117217; MGC138857; |
Gene ID | 5878 |
mRNA Refseq | NM_001252039 |
Protein Refseq | NP_001238968 |
MIM | 604037 |
UniProt ID | P51148 |
◆ Recombinant Proteins | ||
RAB5C-532H | Recombinant Human RAB5C, member RAS oncogene family, His-tagged | +Inquiry |
Rab5c-5327M | Recombinant Mouse Rab5c Protein, Myc/DDK-tagged | +Inquiry |
RAB5C-7361M | Recombinant Mouse RAB5C Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB5C-1231H | Recombinant Human RAB5C protein, GST-tagged | +Inquiry |
RAB5C-11546Z | Recombinant Zebrafish RAB5C | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB5C-524HCL | Recombinant Human RAB5C lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB5C Products
Required fields are marked with *
My Review for All RAB5C Products
Required fields are marked with *
0
Inquiry Basket