Recombinant Human RAB5C protein, His-SUMO-tagged
| Cat.No. : | RAB5C-3404H |
| Product Overview : | Recombinant Human RAB5C protein(P51148)(1-216aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-216aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.5 kDa |
| AA Sequence : | MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | RAB5C RAB5C, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB5C |
| Synonyms | RAB5C; RAB5C, member RAS oncogene family; RABL; ras-related protein Rab-5C; RAB; member of RAS oncogene family like; member of RAS oncogene family; RAB5CL; RAB5C, member of RAS oncogene family; L1880; RAB5L; MGC117217; MGC138857; |
| Gene ID | 5878 |
| mRNA Refseq | NM_001252039 |
| Protein Refseq | NP_001238968 |
| MIM | 604037 |
| UniProt ID | P51148 |
| ◆ Recombinant Proteins | ||
| RAB5C-7361M | Recombinant Mouse RAB5C Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB5C-054H | Recombinant Human RAB5C Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RAB5C-13835M | Recombinant Mouse RAB5C Protein | +Inquiry |
| RAB5C-11546Z | Recombinant Zebrafish RAB5C | +Inquiry |
| RAB5C-1839H | Recombinant Human RAB5C Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB5C-524HCL | Recombinant Human RAB5C lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB5C Products
Required fields are marked with *
My Review for All RAB5C Products
Required fields are marked with *



