Recombinant Human RAB5C Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB5C-054H
Product Overview : RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment.
Molecular Mass : 23.3 kDa
AA Sequence : MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB5C RAB5C, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB5C
Synonyms RAB5C; RAB5C, member RAS oncogene family; L1880; RAB5CL; RAB5L; RABL; ras-related protein Rab-5C; RAB5C, member of RAS oncogene family
Gene ID 5878
mRNA Refseq NM_201434
Protein Refseq NP_958842
MIM 604037
UniProt ID P51148

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB5C Products

Required fields are marked with *

My Review for All RAB5C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon