Recombinant Human RAB5C Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RAB5C-054H |
| Product Overview : | RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment. |
| Molecular Mass : | 23.3 kDa |
| AA Sequence : | MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RAB5C RAB5C, member RAS oncogene family [ Homo sapiens (human) ] |
| Official Symbol | RAB5C |
| Synonyms | RAB5C; RAB5C, member RAS oncogene family; L1880; RAB5CL; RAB5L; RABL; ras-related protein Rab-5C; RAB5C, member of RAS oncogene family |
| Gene ID | 5878 |
| mRNA Refseq | NM_201434 |
| Protein Refseq | NP_958842 |
| MIM | 604037 |
| UniProt ID | P51148 |
| ◆ Recombinant Proteins | ||
| Rab5c-5327M | Recombinant Mouse Rab5c Protein, Myc/DDK-tagged | +Inquiry |
| RAB5C-1839H | Recombinant Human RAB5C Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB5C-306H | Recombinant Human RAB5C Protein, MYC/DDK-tagged | +Inquiry |
| RAB5C-532H | Recombinant Human RAB5C, member RAS oncogene family, His-tagged | +Inquiry |
| RAB5C-1231H | Recombinant Human RAB5C protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB5C-524HCL | Recombinant Human RAB5C lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB5C Products
Required fields are marked with *
My Review for All RAB5C Products
Required fields are marked with *



