Recombinant Human RABEPK protein, GST-tagged
Cat.No. : | RABEPK-301308H |
Product Overview : | Recombinant Human RABEPK (1-372 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Asp372 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNGSFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRHGHVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVAMGKHVYIFGGMTPAGALDTMYQYHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RABEPK Rab9 effector protein with kelch motifs [ Homo sapiens ] |
Official Symbol | RABEPK |
Synonyms | RABEPK; Rab9 effector protein with kelch motifs; rab9 effector protein with kelch motifs; bA65N13.1; RAB9P40; Rab9 effector p40; 40 kDa Rab9 effector protein; p40; DKFZp686P1077; |
Gene ID | 10244 |
mRNA Refseq | NM_001174152 |
Protein Refseq | NP_001167623 |
MIM | 605962 |
UniProt ID | Q7Z6M1 |
◆ Recombinant Proteins | ||
RABEPK-3363H | Recombinant Human RABEPK protein, His-tagged | +Inquiry |
RABEPK-13846M | Recombinant Mouse RABEPK Protein | +Inquiry |
RABEPK-7369M | Recombinant Mouse RABEPK Protein, His (Fc)-Avi-tagged | +Inquiry |
RABEPK-4563R | Recombinant Rat RABEPK Protein, His (Fc)-Avi-tagged | +Inquiry |
RABEPK-1783HFL | Recombinant Full Length Human RABEPK Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RABEPK-525HCL | Recombinant Human RABEPK lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RABEPK Products
Required fields are marked with *
My Review for All RABEPK Products
Required fields are marked with *