Recombinant Human RABIF protein, GST-tagged
| Cat.No. : | RABIF-2143H |
| Product Overview : | Recombinant Human RABIF protein(1-123 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | May 23, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-123 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RABIF RAB interacting factor [ Homo sapiens ] |
| Official Symbol | RABIF |
| Synonyms | RABIF; RAB interacting factor; RASGRF3; guanine nucleotide exchange factor MSS4; mss4; rab-interacting factor; mammalian suppressor of SEC4; Ras-specific guanine-releasing factor 3; MSS4; RASGFR3; |
| Gene ID | 5877 |
| mRNA Refseq | NM_002871 |
| Protein Refseq | NP_002862 |
| MIM | 603417 |
| UniProt ID | P47224 |
| ◆ Recombinant Proteins | ||
| RABIF-28530TH | Recombinant Human RABIF, His-tagged | +Inquiry |
| RABIF-636Z | Recombinant Zebrafish RABIF | +Inquiry |
| RABIF-3766R | Recombinant Rhesus monkey RABIF Protein, His-tagged | +Inquiry |
| RABIF-2799H | Recombinant Human RAB Interacting Factor, His-tagged | +Inquiry |
| RABIF-2143H | Recombinant Human RABIF protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RABIF-2571HCL | Recombinant Human RABIF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RABIF Products
Required fields are marked with *
My Review for All RABIF Products
Required fields are marked with *
