Recombinant Human RABIF protein, GST-tagged
Cat.No. : | RABIF-2143H |
Product Overview : | Recombinant Human RABIF protein(1-123 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | July 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-123 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | RABIF RAB interacting factor [ Homo sapiens ] |
Official Symbol | RABIF |
Synonyms | RABIF; RAB interacting factor; RASGRF3; guanine nucleotide exchange factor MSS4; mss4; rab-interacting factor; mammalian suppressor of SEC4; Ras-specific guanine-releasing factor 3; MSS4; RASGFR3; |
Gene ID | 5877 |
mRNA Refseq | NM_002871 |
Protein Refseq | NP_002862 |
MIM | 603417 |
UniProt ID | P47224 |
◆ Recombinant Proteins | ||
Rabif-5341M | Recombinant Mouse Rabif Protein, Myc/DDK-tagged | +Inquiry |
RABIF-7374M | Recombinant Mouse RABIF Protein, His (Fc)-Avi-tagged | +Inquiry |
RABIF-28530TH | Recombinant Human RABIF, His-tagged | +Inquiry |
RABIF-636Z | Recombinant Zebrafish RABIF | +Inquiry |
RABIF-2799H | Recombinant Human RAB Interacting Factor, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RABIF-2571HCL | Recombinant Human RABIF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RABIF Products
Required fields are marked with *
My Review for All RABIF Products
Required fields are marked with *