Recombinant Human RABIF Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RABIF-5749H
• Product Overview: RABIF MS Standard C13 and N15-labeled recombinant protein (NP_002862) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the SCE4/YPT1/RAB family of small GTP-binding proteins that are involved in the regulation of intracellular vesicular transport. This protein stimulates GTP-GDP exchange in SEC4, and to a lesser extent in YPT1 and RAB3A, and may play a general role in vesicular transport.
• Molecular Mass: 13.8 kDa
• AA Sequence: MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RABIF RAB interacting factor [ Homo sapiens (human) ]
• Official Symbol: RABIF
• Synonyms: RABIF; RAB interacting factor; RASGRF3; guanine nucleotide exchange factor MSS4; mss4; rab-interacting factor; mammalian suppressor of SEC4; Ras-specific guanine-releasing factor 3; MSS4; RASGFR3
• Gene ID: 5877
• mRNA Refseq: NM_002871
• Protein Refseq: NP_002862
• MIM: 603417
• UniProt ID: P47224