Recombinant Human RABIF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RABIF-5749H |
Product Overview : | RABIF MS Standard C13 and N15-labeled recombinant protein (NP_002862) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the SCE4/YPT1/RAB family of small GTP-binding proteins that are involved in the regulation of intracellular vesicular transport. This protein stimulates GTP-GDP exchange in SEC4, and to a lesser extent in YPT1 and RAB3A, and may play a general role in vesicular transport. |
Molecular Mass : | 13.8 kDa |
AA Sequence : | MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RABIF RAB interacting factor [ Homo sapiens (human) ] |
Official Symbol | RABIF |
Synonyms | RABIF; RAB interacting factor; RASGRF3; guanine nucleotide exchange factor MSS4; mss4; rab-interacting factor; mammalian suppressor of SEC4; Ras-specific guanine-releasing factor 3; MSS4; RASGFR3; |
Gene ID | 5877 |
mRNA Refseq | NM_002871 |
Protein Refseq | NP_002862 |
MIM | 603417 |
UniProt ID | P47224 |
◆ Recombinant Proteins | ||
RABIF-28530TH | Recombinant Human RABIF, His-tagged | +Inquiry |
RABIF-5749H | Recombinant Human RABIF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Rabif-5341M | Recombinant Mouse Rabif Protein, Myc/DDK-tagged | +Inquiry |
RABIF-636Z | Recombinant Zebrafish RABIF | +Inquiry |
RABIF-2143H | Recombinant Human RABIF, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RABIF-2571HCL | Recombinant Human RABIF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RABIF Products
Required fields are marked with *
My Review for All RABIF Products
Required fields are marked with *