Recombinant Human RABIF Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RABIF-5749H
Product Overview : RABIF MS Standard C13 and N15-labeled recombinant protein (NP_002862) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the SCE4/YPT1/RAB family of small GTP-binding proteins that are involved in the regulation of intracellular vesicular transport. This protein stimulates GTP-GDP exchange in SEC4, and to a lesser extent in YPT1 and RAB3A, and may play a general role in vesicular transport.
Molecular Mass : 13.8 kDa
AA Sequence : MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RABIF RAB interacting factor [ Homo sapiens (human) ]
Official Symbol RABIF
Synonyms RABIF; RAB interacting factor; RASGRF3; guanine nucleotide exchange factor MSS4; mss4; rab-interacting factor; mammalian suppressor of SEC4; Ras-specific guanine-releasing factor 3; MSS4; RASGFR3;
Gene ID 5877
mRNA Refseq NM_002871
Protein Refseq NP_002862
MIM 603417
UniProt ID P47224

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RABIF Products

Required fields are marked with *

My Review for All RABIF Products

Required fields are marked with *

0
cart-icon
0
compare icon