Recombinant Human RAD18
| Cat.No. : | RAD18-29579TH |
| Product Overview : | Recombinant fragment corresponding to aa 332-430 of human RAD18 with a proprietary tag; 36.52 inclusive of tag; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Description : | The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif.Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. |
| Molecular Weight : | 36.520kDa |
| Biological activity : | useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: (Glutathione is reduced) |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV |
| Sequence Similarities : | Belongs to the RAD18 family.Contains 1 RING-type zinc finger.Contains 1 SAP domain.Contains 1 UBZ-type zinc finger. |
| Gene Name | RAD18 RAD18 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | RAD18 |
| Synonyms | RAD18; RAD18 homolog (S. cerevisiae); E3 ubiquitin-protein ligase RAD18; RNF73; |
| Gene ID | 56852 |
| mRNA Refseq | NM_020165 |
| Protein Refseq | NP_064550 |
| MIM | 605256 |
| Uniprot ID | Q9NS91 |
| Chromosome Location | 3p25-p24 |
| Function | Y-form DNA binding; damaged DNA binding; ligase activity; metal ion binding; protein binding; |
| ◆ Recombinant Proteins | ||
| RAD18-29579TH | Recombinant Human RAD18 | +Inquiry |
| RAD18-1848H | Recombinant Human RAD18 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAD18-1151H | Recombinant Human RAD18 Protein (1-495 aa), His-SUMO-tagged | +Inquiry |
| RAD18-29578TH | Recombinant Human RAD18 | +Inquiry |
| Rad18-5347M | Recombinant Mouse Rad18 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAD18-2561HCL | Recombinant Human RAD18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAD18 Products
Required fields are marked with *
My Review for All RAD18 Products
Required fields are marked with *
