Recombinant Human RAD18

Cat.No. : RAD18-29579TH
Product Overview : Recombinant fragment corresponding to aa 332-430 of human RAD18 with a proprietary tag; 36.52 inclusive of tag;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif.Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens.
Molecular Weight : 36.520kDa
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: (Glutathione is reduced)
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
Sequence Similarities : Belongs to the RAD18 family.Contains 1 RING-type zinc finger.Contains 1 SAP domain.Contains 1 UBZ-type zinc finger.
Gene Name RAD18 RAD18 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol RAD18
Synonyms RAD18; RAD18 homolog (S. cerevisiae); E3 ubiquitin-protein ligase RAD18; RNF73;
Gene ID 56852
mRNA Refseq NM_020165
Protein Refseq NP_064550
MIM 605256
Uniprot ID Q9NS91
Chromosome Location 3p25-p24
Function Y-form DNA binding; damaged DNA binding; ligase activity; metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAD18 Products

Required fields are marked with *

My Review for All RAD18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon