Recombinant Human RAD18

• Cat.No.: RAD18-29579TH
• Product Overview: Recombinant fragment corresponding to aa 332-430 of human RAD18 with a proprietary tag; 36.52 inclusive of tag

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif.Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens.
• Molecular Weight: 36.520kDa
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: (Glutathione is reduced)
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
• Sequence Similarities: Belongs to the RAD18 family.Contains 1 RING-type zinc finger.Contains 1 SAP domain.Contains 1 UBZ-type zinc finger.

Gene Information

• Gene Name: RAD18 RAD18 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: RAD18
• Synonyms: RAD18; RAD18 homolog (S. cerevisiae); E3 ubiquitin-protein ligase RAD18; RNF73
• Gene ID: 56852
• mRNA Refseq: NM_020165
• Protein Refseq: NP_064550
• MIM: 605256
• Uniprot ID: Q9NS91
• Chromosome Location: 3p25-p24
• Function: Y-form DNA binding; damaged DNA binding; ligase activity; metal ion binding; protein binding