Recombinant Human RAD51C
| Cat.No. : | RAD51C-28601TH |
| Product Overview : | Recombinant fragment of Human Rad51C with a N terminal proprietary tag; Predicted MWt 40.48 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 134 amino acids |
| Description : | This gene is a member of the RAD51 family of related genes, which encode strand-transfer proteins thought to be involved in recombinational repair of damaged DNA and in meiotic recombination. This gene product interacts with two other DNA repair proteins, encoded by RAD51B and XRCC3, but not with itself. The protein copurifies with XRCC3 protein in a complex, reflecting their endogenous association and suggesting a cooperative role during recombinational repair. This gene is one of four localized to a region of chromosome 17q23 where amplification occurs frequently in breast tumors. Overexpression of the four genes during amplification has been observed and suggests a possible role in tumor progression. Alternative splicing has been observed for this gene and two variants encoding different isoforms have been identified. |
| Molecular Weight : | 40.480kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL |
| Gene Name | RAD51C RAD51 homolog C (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | RAD51C |
| Synonyms | RAD51C; RAD51 homolog C (S. cerevisiae); RAD51 (S. cerevisiae) homolog C; DNA repair protein RAD51 homolog 3; RAD51L2; |
| Gene ID | 5889 |
| mRNA Refseq | NM_002876 |
| Protein Refseq | NP_002867 |
| MIM | 602774 |
| Uniprot ID | O43502 |
| Chromosome Location | 17q25.1 |
| Pathway | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem; Fanconi anemia pathway, conserved biosystem; Hemostasis, organism-specific biosystem; Homologous recombination, organism-specific biosystem; |
| Function | ATP binding; DNA binding; DNA-dependent ATPase activity; crossover junction endodeoxyribonuclease activity; nucleoside-triphosphatase activity; |
| ◆ Recombinant Proteins | ||
| RAD51C-680H | Recombinant Human RAD51C Protein, His-tagged | +Inquiry |
| RAD51C-13872M | Recombinant Mouse RAD51C Protein | +Inquiry |
| RAD51C-1607Z | Recombinant Zebrafish RAD51C | +Inquiry |
| RAD51C-6844H | Recombinant Human RAD51C protein, GST-tagged | +Inquiry |
| RAD51C-7387M | Recombinant Mouse RAD51C Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAD51C-2555HCL | Recombinant Human RAD51C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAD51C Products
Required fields are marked with *
My Review for All RAD51C Products
Required fields are marked with *
