Recombinant Human RAD52 protein, GST-tagged
Cat.No. : | RAD52-301602H |
Product Overview : | Recombinant Human RAD52 (234-418 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met234-Ser418 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RAD52 RAD52 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RAD52 |
Synonyms | RAD52; RAD52 homolog (S. cerevisiae); RAD52 (S. cerevisiae) homolog; DNA repair protein RAD52 homolog; recombination protein RAD52; rhabdomyosarcoma antigen MU-RMS-40.23; |
Gene ID | 5893 |
mRNA Refseq | NM_134424 |
Protein Refseq | NP_602296 |
MIM | 600392 |
UniProt ID | P43351 |
◆ Recombinant Proteins | ||
Rad52-5351M | Recombinant Mouse Rad52 Protein, Myc/DDK-tagged | +Inquiry |
RAD52-682H | Recombinant Human RAD52 Protein, MYC/DDK-tagged | +Inquiry |
RAD52-957S | Recombinant Saccharomyces Cerevisiae RAD52 Protein (60-282 aa), His-SUMO-tagged | +Inquiry |
RAD52-4200B | Recombinant Baker's yeast RAD52 protein, His-SUMO-tagged | +Inquiry |
RAD52-1565HFL | Recombinant Full Length Human RAD52 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAD52 Products
Required fields are marked with *
My Review for All RAD52 Products
Required fields are marked with *