Recombinant Human RAD52 protein, GST-tagged
| Cat.No. : | RAD52-301602H |
| Product Overview : | Recombinant Human RAD52 (234-418 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met234-Ser418 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | RAD52 RAD52 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | RAD52 |
| Synonyms | RAD52; RAD52 homolog (S. cerevisiae); RAD52 (S. cerevisiae) homolog; DNA repair protein RAD52 homolog; recombination protein RAD52; rhabdomyosarcoma antigen MU-RMS-40.23; |
| Gene ID | 5893 |
| mRNA Refseq | NM_134424 |
| Protein Refseq | NP_602296 |
| MIM | 600392 |
| UniProt ID | P43351 |
| ◆ Recombinant Proteins | ||
| RAD52-2667H | Recombinant Human RAD52 Homolog (S. Cerevisiae) | +Inquiry |
| RAD52-1852H | Recombinant Human RAD52 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAD52-4029C | Recombinant Chicken RAD52 | +Inquiry |
| RAD52-4200B | Recombinant Baker's yeast RAD52 protein, His-SUMO-tagged | +Inquiry |
| RAD52-13875M | Recombinant Mouse RAD52 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAD52 Products
Required fields are marked with *
My Review for All RAD52 Products
Required fields are marked with *
