Recombinant Human RAE1 protein, GST-tagged
Cat.No. : | RAE1-3408H |
Product Overview : | Recombinant Human RAE1 protein(P78406)(1-368aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-368aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 68 kDa |
AA Sequence : | MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RAE1 RAE1 RNA export 1 homolog (S. pombe) [ Homo sapiens ] |
Official Symbol | RAE1 |
Synonyms | RAE1; RAE1 RNA export 1 homolog (S. pombe); RAE1 (RNA export 1, S.pombe) homolog; mRNA export factor; Mnrp41; mRNA export protein; rae1 protein homolog; migration-inducing gene 14; mRNA-binding protein, 41-kD; mRNA-associated protein MRNP 41; homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer); MIG14; MRNP41; dJ481F12.3; dJ800J21.1; FLJ30608; MGC117333; MGC126076; MGC126077; |
Gene ID | 8480 |
mRNA Refseq | NM_001015885 |
Protein Refseq | NP_001015885 |
MIM | 603343 |
UniProt ID | P78406 |
◆ Recombinant Proteins | ||
RAE1-11231Z | Recombinant Zebrafish RAE1 | +Inquiry |
RAE1-4037H | Recombinant Human RAE1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAE1-4912R | Recombinant Rat RAE1 Protein | +Inquiry |
RAE1-29369TH | Recombinant Human RAE1, His-tagged | +Inquiry |
RAE1-2160H | Recombinant Human RAE1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAE1-2550HCL | Recombinant Human RAE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAE1 Products
Required fields are marked with *
My Review for All RAE1 Products
Required fields are marked with *
0
Inquiry Basket