Recombinant Human RAE1 protein, GST-tagged

Cat.No. : RAE1-3408H
Product Overview : Recombinant Human RAE1 protein(P78406)(1-368aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-368aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 68 kDa
AA Sequence : MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name RAE1 RAE1 RNA export 1 homolog (S. pombe) [ Homo sapiens ]
Official Symbol RAE1
Synonyms RAE1; RAE1 RNA export 1 homolog (S. pombe); RAE1 (RNA export 1, S.pombe) homolog; mRNA export factor; Mnrp41; mRNA export protein; rae1 protein homolog; migration-inducing gene 14; mRNA-binding protein, 41-kD; mRNA-associated protein MRNP 41; homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer); MIG14; MRNP41; dJ481F12.3; dJ800J21.1; FLJ30608; MGC117333; MGC126076; MGC126077;
Gene ID 8480
mRNA Refseq NM_001015885
Protein Refseq NP_001015885
MIM 603343
UniProt ID P78406

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAE1 Products

Required fields are marked with *

My Review for All RAE1 Products

Required fields are marked with *

0
cart-icon