Recombinant Human RALGPS1 Protein (1-305 aa), His-SUMO-tagged
| Cat.No. : | RALGPS1-1025H |
| Product Overview : | Recombinant Human RALGPS1 Protein (1-305 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Isoform 4. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-305 aa |
| Description : | Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization . Guanine nucleotide exchange factor for. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 50.7 kDa |
| AA Sequence : | MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | RALGPS1 Ral GEF with PH domain and SH3 binding motif 1 [ Homo sapiens ] |
| Official Symbol | RALGPS1 |
| Synonyms | RALGPS1; KIAA0351; RALGEF2; RALGPS1A; RalGEF 2; RP13-225O21.1; |
| Gene ID | 9649 |
| mRNA Refseq | NM_001190728 |
| Protein Refseq | NP_001177657 |
| MIM | 614444 |
| UniProt ID | Q5JS13 |
| ◆ Recombinant Proteins | ||
| RALGPS1-5884Z | Recombinant Zebrafish RALGPS1 | +Inquiry |
| RALGPS1-1025H | Recombinant Human RALGPS1 Protein (1-305 aa), His-SUMO-tagged | +Inquiry |
| RALGPS1-5744H | Recombinant Human RALGPS1 protein, GST-tagged | +Inquiry |
| RALGPS1-7407M | Recombinant Mouse RALGPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RALGPS1-13901M | Recombinant Mouse RALGPS1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RALGPS1-1465HCL | Recombinant Human RALGPS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RALGPS1 Products
Required fields are marked with *
My Review for All RALGPS1 Products
Required fields are marked with *
