Recombinant Human RALGPS1 Protein (1-305 aa), His-SUMO-tagged
Cat.No. : | RALGPS1-1025H |
Product Overview : | Recombinant Human RALGPS1 Protein (1-305 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Isoform 4. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-305 aa |
Description : | Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization . Guanine nucleotide exchange factor for. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | RALGPS1 Ral GEF with PH domain and SH3 binding motif 1 [ Homo sapiens ] |
Official Symbol | RALGPS1 |
Synonyms | RALGPS1; KIAA0351; RALGEF2; RALGPS1A; RalGEF 2; RP13-225O21.1; |
Gene ID | 9649 |
mRNA Refseq | NM_001190728 |
Protein Refseq | NP_001177657 |
MIM | 614444 |
UniProt ID | Q5JS13 |
◆ Recombinant Proteins | ||
RALGPS1-13901M | Recombinant Mouse RALGPS1 Protein | +Inquiry |
RALGPS1-5884Z | Recombinant Zebrafish RALGPS1 | +Inquiry |
RALGPS1-7407M | Recombinant Mouse RALGPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RALGPS1-5744H | Recombinant Human RALGPS1 protein, GST-tagged | +Inquiry |
RALGPS1-1025H | Recombinant Human RALGPS1 Protein (1-305 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RALGPS1-1465HCL | Recombinant Human RALGPS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RALGPS1 Products
Required fields are marked with *
My Review for All RALGPS1 Products
Required fields are marked with *