Recombinant Human RANBP2 protein, His-B2M-tagged
Cat.No. : | RANBP2-3410H |
Product Overview : | Recombinant Human RANBP2 protein(P49792)(2601-2802aa), fused to N-terminal His-B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 2601-2802aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.8 kDa |
AA Sequence : | PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RANBP2 RAN binding protein 2 [ Homo sapiens ] |
Official Symbol | RANBP2 |
Synonyms | RANBP2; RAN binding protein 2; E3 SUMO-protein ligase RanBP2; NUP358; P270; nucleoporin 358; nucleoporin Nup358; 358 kDa nucleoporin; ran-binding protein 2; transformation-related protein 2; nuclear pore complex protein Nup358; ANE1; TRP1; TRP2; IIAE3; |
Gene ID | 5903 |
mRNA Refseq | NM_006267 |
Protein Refseq | NP_006258 |
MIM | 601181 |
UniProt ID | P49792 |
◆ Recombinant Proteins | ||
RANBP2-3410H | Recombinant Human RANBP2 protein, His-B2M-tagged | +Inquiry |
RANBP2-13912M | Recombinant Mouse RANBP2 Protein | +Inquiry |
RANBP2-7414M | Recombinant Mouse RANBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RANBP2-2250H | Recombinant Human RANBP2 Protein (2601-2802 aa), His-tagged | +Inquiry |
RANBP2-2386H | Active Recombinant Human RANBP2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RANBP2 Products
Required fields are marked with *
My Review for All RANBP2 Products
Required fields are marked with *