Recombinant Human RANBP2 protein, His-B2M-tagged

• Cat.No.: RANBP2-3410H
• Product Overview: Recombinant Human RANBP2 protein(P49792)(2601-2802aa), fused to N-terminal His-B2M tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: B2M&His
• Protein Length: 2601-2802aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.8 kDa
• AA Sequence: PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RANBP2 RAN binding protein 2 [ Homo sapiens ]
• Official Symbol: RANBP2
• Synonyms: RANBP2; RAN binding protein 2; E3 SUMO-protein ligase RanBP2; NUP358; P270; nucleoporin 358; nucleoporin Nup358; 358 kDa nucleoporin; ran-binding protein 2; transformation-related protein 2; nuclear pore complex protein Nup358; ANE1; TRP1; TRP2; IIAE3
• Gene ID: 5903
• mRNA Refseq: NM_006267
• Protein Refseq: NP_006258
• MIM: 601181
• UniProt ID: P49792