Recombinant Human RANGAP1 protein, GST-tagged
| Cat.No. : | RANGAP1-38H |
| Product Overview : | Recombinant Human RANGAP1(1 a.a. - 587 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-587 a.a. |
| Description : | This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding and exchange. Alternative splicing results in multiple transcript variants. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 90.31 kDa |
| AA Sequence : | MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEK KSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLN NCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGI TALAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNL SFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDDEDEEEEEEGEEEEEE AEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLG PKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKS EDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | RANGAP1 Ran GTPase activating protein 1 [ Homo sapiens ] |
| Official Symbol | RANGAP1 |
| Synonyms | RANGAP1; Ran GTPase activating protein 1; SD, segregation distorter homolog (Drosophila); ran GTPase-activating protein 1; Fug1; KIAA1835; segregation distortion; segregation distorter homolog; SD; MGC20266; |
| Gene ID | 5905 |
| mRNA Refseq | NM_002883 |
| Protein Refseq | NP_002874 |
| MIM | 602362 |
| UniProt ID | P46060 |
| Chromosome Location | 22q13 |
| Pathway | Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; Disease, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; Host Interactions of HIV factors, organism-specific biosystem; |
| Function | GTPase activator activity; Ran GTPase activator activity; protein binding; |
| ◆ Recombinant Proteins | ||
| RANGAP1-7416M | Recombinant Mouse RANGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RANGAP1-4293HFL | Recombinant Full Length Human RANGAP1 protein, Flag-tagged | +Inquiry |
| RANGAP1-12H | Recombinant Human RANGAP1 Protein, His-tagged | +Inquiry |
| RANGAP1-42H | Recombinant Human RANGAP1 protein, MYC/DDK-tagged | +Inquiry |
| Rangap1-5370M | Recombinant Mouse Rangap1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RANGAP1-2532HCL | Recombinant Human RANGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RANGAP1 Products
Required fields are marked with *
My Review for All RANGAP1 Products
Required fields are marked with *
