| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
135 amino acids |
| Description : |
This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein. |
| Molecular Weight : |
15.600kDa |
| Tissue specificity : |
Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon. |
| Biological activity : |
Determined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml. |
| Form : |
Lyophilised:Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% B |
| Purity : |
by SDS-PAGE |
| Storage buffer : |
Preservative: None |
| Storage : |
The lyophilized protein is stable at room temperature for up to 1 month. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C. Avoid repeated freeze/thaw cycles. See reconstitution notes |
| Sequences of amino acids : |
ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFA |