Recombinant Human RARRES2

Cat.No. : RARRES2-27066TH
Product Overview : Recombinant fragment corresponding to amino acids 21-155 of Human Chemerin; 135 amino acids, MWt 15.6 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 135 amino acids
Description : This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein.
Molecular Weight : 15.600kDa
Tissue specificity : Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.
Biological activity : Determined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml.
Form : Lyophilised:Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% B
Purity : by SDS-PAGE
Storage buffer : Preservative: None
Storage : The lyophilized protein is stable at room temperature for up to 1 month. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C. Avoid repeated freeze/thaw cycles. See reconstitution notes
Sequences of amino acids : ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFA
Gene Name RARRES2 retinoic acid receptor responder (tazarotene induced) 2 [ Homo sapiens ]
Official Symbol RARRES2
Synonyms RARRES2; retinoic acid receptor responder (tazarotene induced) 2; retinoic acid receptor responder protein 2; chemerin; HP10433; TIG2;
Gene ID 5919
mRNA Refseq NM_002889
Protein Refseq NP_002880
MIM 601973
Uniprot ID Q99969
Chromosome Location 7q36.1
Function receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RARRES2 Products

Required fields are marked with *

My Review for All RARRES2 Products

Required fields are marked with *

0
cart-icon