Recombinant Human RASGRP1 protein, GST-tagged

• Cat.No.: RASGRP1-8966H
• Product Overview: Recombinant Human RASGRP1 protein(678-797 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 678-797 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: QPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS
• Purity: 90%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: RASGRP1 RAS guanyl releasing protein 1 (calcium and DAG-regulated) [ Homo sapiens ]
• Official Symbol: RASGRP1
• Synonyms: RASGRP1; RAS guanyl releasing protein 1 (calcium and DAG-regulated); RAS guanyl-releasing protein 1; CalDAG GEFII; RASGRP; ras activator RasGRP; RAS guanyl nucleotide-releasing protein 1; calcium and DAG-regulated guanine nucleotide exchange factor II; guanine nucleotide exchange factor, calcium- and DAG-regulated, Rap1A; V; hRasGRP1; CALDAG-GEFI; CALDAG-GEFII; MGC129998; MGC129999
• mRNA Refseq: NM_001128602
• Protein Refseq: NP_001122074
• MIM: 603962
• UniProt ID: O95267
• Gene ID: 10125