Recombinant Human RASGRP2, His-tagged
| Cat.No. : | RASGRP2-31042TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 230-609 of Human RASGRP2 with an N terminal His tag. Observed mwt: 50 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 230-609 a.a. |
| Description : | The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Three alternatively spliced transcript variants encoding the same protein have been found for this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 124 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPET IKLWEGLTELVTATGNYGNYRRRLAACVGFRFPILGVH LKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQRE PRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQALV VEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSA FGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNF QESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQ CKDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSL PRPGRRGSRPPEIREEEVQTVEDGVFDIHL |
| Gene Name | RASGRP2 RAS guanyl releasing protein 2 (calcium and DAG-regulated) [ Homo sapiens ] |
| Official Symbol | RASGRP2 |
| Synonyms | RASGRP2; RAS guanyl releasing protein 2 (calcium and DAG-regulated); RAS guanyl-releasing protein 2; CALDAG GEFI; |
| Gene ID | 10235 |
| mRNA Refseq | NM_001098670 |
| Protein Refseq | NP_001092140 |
| MIM | 605577 |
| Uniprot ID | Q7LDG7 |
| Chromosome Location | 11q13 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Effects of PIP2 hydrolysis, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; |
| Function | calcium ion binding; calcium ion binding; diacylglycerol binding; guanyl-nucleotide exchange factor activity; lipid binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RASGRP2 Products
Required fields are marked with *
My Review for All RASGRP2 Products
Required fields are marked with *




