Recombinant Human RASL10A Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: RASL10A-229H
• Product Overview: RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_001007280) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Potent inhibitor of cellular proliferation.
• Molecular Mass: 12.5 kDa
• AA Sequence: MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RASL10A RAS-like, family 10, member A [ Homo sapiens (human) ]
• Official Symbol: RASL10A
• Synonyms: RASL10A; RAS-like, family 10, member A; ras-like protein family member 10A; RRP22; ras-like protein RRP22; RAS-related on chromosome 22; ras-related protein on chromosome 22
• Gene ID: 10633
• mRNA Refseq: NM_001007279
• Protein Refseq: NP_001007280
• MIM: 602220
• UniProt ID: Q92737