Recombinant Human RASL10A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RASL10A-2409H |
Product Overview : | RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_006468) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Potent inhibitor of cellular proliferation. |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MGGSLRVAVLGAPGVGKTAIIRQFVFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGPRRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RASL10A RAS like family 10 member A [ Homo sapiens (human) ] |
Official Symbol | RASL10A |
Synonyms | RASL10A; RAS-like, family 10, member A; ras-like protein family member 10A; RRP22; ras-like protein RRP22; RAS-related on chromosome 22; ras-related protein on chromosome 22; |
Gene ID | 10633 |
mRNA Refseq | NM_006477 |
Protein Refseq | NP_006468 |
MIM | 602220 |
UniProt ID | Q92737 |
◆ Recombinant Proteins | ||
RASL10A-13957M | Recombinant Mouse RASL10A Protein | +Inquiry |
RASL10A-3795R | Recombinant Rhesus monkey RASL10A Protein, His-tagged | +Inquiry |
RASL10A-3612R | Recombinant Rhesus Macaque RASL10A Protein, His (Fc)-Avi-tagged | +Inquiry |
RASL10A-2409H | Recombinant Human RASL10A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RASL10A-229H | Recombinant Human RASL10A Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASL10A-2502HCL | Recombinant Human RASL10A 293 Cell Lysate | +Inquiry |
RASL10A-2503HCL | Recombinant Human RASL10A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RASL10A Products
Required fields are marked with *
My Review for All RASL10A Products
Required fields are marked with *
0
Inquiry Basket