Recombinant Human RASL10A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RASL10A-2409H
Product Overview : RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_006468) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Potent inhibitor of cellular proliferation.
Molecular Mass : 22.5 kDa
AA Sequence : MGGSLRVAVLGAPGVGKTAIIRQFVFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGPRRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RASL10A RAS like family 10 member A [ Homo sapiens (human) ]
Official Symbol RASL10A
Synonyms RASL10A; RAS-like, family 10, member A; ras-like protein family member 10A; RRP22; ras-like protein RRP22; RAS-related on chromosome 22; ras-related protein on chromosome 22;
Gene ID 10633
mRNA Refseq NM_006477
Protein Refseq NP_006468
MIM 602220
UniProt ID Q92737

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RASL10A Products

Required fields are marked with *

My Review for All RASL10A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon