Recombinant Human RAX2 Protein, GST-tagged
| Cat.No. : | RAX2-4353H |
| Product Overview : | Human MGC15631 full-length ORF ( NP_116142.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation of this gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneath the retinal pigment epithelium and within the Bruchs membrane. Defects in this gene can also cause cone-rod dystrophy type 11, a disease characterized by the initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed by the degeneration of rod photoreceptor cells, which progresses to night blindness and the loss of peripheral vision. [provided by RefSeq |
| Molecular Mass : | 46.5 kDa |
| AA Sequence : | MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RAX2 retina and anterior neural fold homeobox 2 [ Homo sapiens ] |
| Official Symbol | RAX2 |
| Synonyms | RAX2; retina and anterior neural fold homeobox 2; RAXL1, retina and anterior neural fold homeobox like 1; retina and anterior neural fold homeobox protein 2; MGC15631; Q50-type retinal homeobox protein; retina and anterior neural fold homeobox like 1; retina and anterior neural fold homeobox-like protein 1; QRX; ARMD6; RAXL1; CORD11; |
| Gene ID | 84839 |
| mRNA Refseq | NM_032753 |
| Protein Refseq | NP_116142 |
| MIM | 610362 |
| UniProt ID | Q96IS3 |
| ◆ Recombinant Proteins | ||
| RAX2-6144HF | Recombinant Full Length Human RAX2 Protein, GST-tagged | +Inquiry |
| RAX2-5680C | Recombinant Chicken RAX2 | +Inquiry |
| RAX2-4353H | Recombinant Human RAX2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAX2-2491HCL | Recombinant Human RAX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAX2 Products
Required fields are marked with *
My Review for All RAX2 Products
Required fields are marked with *
