Recombinant Human RAX2 Protein, GST-tagged

Cat.No. : RAX2-4353H
Product Overview : Human MGC15631 full-length ORF ( NP_116142.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation of this gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneath the retinal pigment epithelium and within the Bruchs membrane. Defects in this gene can also cause cone-rod dystrophy type 11, a disease characterized by the initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed by the degeneration of rod photoreceptor cells, which progresses to night blindness and the loss of peripheral vision. [provided by RefSeq
Molecular Mass : 46.5 kDa
AA Sequence : MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RAX2 retina and anterior neural fold homeobox 2 [ Homo sapiens ]
Official Symbol RAX2
Synonyms RAX2; retina and anterior neural fold homeobox 2; RAXL1, retina and anterior neural fold homeobox like 1; retina and anterior neural fold homeobox protein 2; MGC15631; Q50-type retinal homeobox protein; retina and anterior neural fold homeobox like 1; retina and anterior neural fold homeobox-like protein 1; QRX; ARMD6; RAXL1; CORD11;
Gene ID 84839
mRNA Refseq NM_032753
Protein Refseq NP_116142
MIM 610362
UniProt ID Q96IS3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAX2 Products

Required fields are marked with *

My Review for All RAX2 Products

Required fields are marked with *

0
cart-icon