Recombinant Human RB1 Protein, GST-tagged
Cat.No. : | RB1-382H |
Product Overview : | Recombinant Human RB1 Protein is produced by in Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 371-470 a.a. |
Description : | The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSI |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | RB1 retinoblastoma 1 [ Homo sapiens ] |
Official Symbol | RB1 |
Synonyms | RB1; retinoblastoma 1; OSRC, osteosarcoma; retinoblastoma-associated protein; RB; retinoblastoma suspectibility protein; pRb; OSRC; pp110; p105-Rb; |
Gene ID | 5925 |
mRNA Refseq | NM_000321 |
Protein Refseq | NP_000312 |
MIM | 614041 |
UniProt ID | P06400 |
◆ Recombinant Proteins | ||
RB1-5989C | Recombinant Chicken RB1 | +Inquiry |
RB1-651H | Recombinant Human RB1 | +Inquiry |
RB1-4856Z | Recombinant Zebrafish RB1 | +Inquiry |
RB1-570H | Recombinant Human RB1, GST-tagged | +Inquiry |
RB1-2509H | Active Recombinant Full Length Human Retinoblastoma 1 / RB1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RB1 Products
Required fields are marked with *
My Review for All RB1 Products
Required fields are marked with *
0
Inquiry Basket